KEGG   Viruses: 9829317
Entry
9829317           CDS       T40000                                 

Gene name
UL39, SaHV-1p17
Definition
(RefSeq) Saimiriine alphaherpesvirus 1; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:10353
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Saimiriine alphaherpesvirus 1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Other DBs
NCBI-GeneID: 9829317
NCBI-ProteinID: YP_003933800
RS: NC_014567
UniProt: E2IUD0
LinkDB
Position
NC_014567:complement(28876..32022)
AA seq 1048 aa
MSSKSKRGLVLYRGVLSATTDEGQSTLETVHRLAPKQPALSSSASGGGRREARKGVPLAR
PFYEDHRRASRVTSGAPGARSRVGGGGTAAVVAHSDRGGRTIETYVCGGPDSQSVQIQCT
NSCFIQCGSNSTMIATGPGWVGGRPVSQLVFATTHASCDAPGDPDETESSDAGDDGTTDD
SPGSLELADADSDESSRISRSETTFSDSSALSSARTSNSFVFCGSKAGAKLASVFDPNEL
PQTAAASRVGDLESTSLNLCLDAANNAAIPRGIEGTFEAPTGAVSLRMAATLREVLLATR
DLGLSVPPFPADMLSPRVFAEYVTRVVNSLKPRVRRSGQLYLLLGRLVHLRIETKAGSFR
RWMESPDIDLDPTLKRDLRVNERALCEVLGAFAGGAEYALKNRGLQSALKYEEFYLRPWG
NGRLESVSQMYTRIAGALATGAREIPEIGTVALGRTGEWIDLFAYFFDALVSHAIVPSTP
AMLYLGGRQRYTSSCYLVNPQRTDSAGVIDAITHNVGDILARHGGIGLSIQSFNGGSSVM
PALKLLDSLVAAHNAGSHRPTGVCVYLEPWHTDVMAVLRMRGLLAGEEARRCDNIFSAMW
MPDLFFKRLIRYMEGERGVMWTLFDGAAGSALSAHHGAEFERLYEKMEEAGGSALTRLPI
QDLAFAIVRSAASTGSPFVMFKDACNRHYLYDTQGSAISCSNLCTEIVHPADARSSGVCN
LASVNLAECVEDGAFSFERLRRAVRACVLMVNVMIDTTRTPNQRCQRGHDRLRSMGIGMQ
GLHTACLRLGLDMSSPEFRELNAEIAEVMLLAAMQASNDLCVAGLPPFADFKRSVYSEGR
FHWEGFAHARPKHSDEWARLRQRVVRHGLRNSQFIALMPTVSSSQVSESSEGFAPVFTNM
FSKVGRAGETLRPNLLLLEAVHEAFGGAALERALDRLEDAQWCVARAFPCLAPDHPLRRF
KTAFEYDQTLLIDLCADRAPYVDHSQSMTLYVTEASDGTLPASALTRLLVHAYKRGLKTG
MYYCKVRKATNSGVFGGSEDLVCTSCVL
NT seq 3147 nt   +upstreamnt  +downstreamnt
atgtcgtctaaatctaaacgcggtctcgtcttgtaccgcggggtcttgtcagcgacgacg
gacgaaggccagagcactctcgagacggtccatcgcttggccccgaaacagccggccctc
tcgagctcggcttcgggaggcggtagacgagaggcgagaaaaggcgtgccattagcgaga
ccgttctacgaggaccatcgtcgagcctctcgagtcacatccggagcaccgggcgcgcgc
tctcgcgtgggtggtgggggcacagccgcggtggtcgcacacagcgaccgcggcggccga
accatcgagacatacgtctgcggtggtccagactcacagagcgttcagatccaatgcacg
aacagctgctttatccagtgcggctcaaactctactatgatagccactggccccggctgg
gtcggggggcgcccggtctctcagctggtgttcgctaccacacacgccagctgcgacgcg
cccggtgatccggacgagacggagtctagcgacgccggggatgacggaacgacagacgac
tccccgggttccctagaactcgcagacgcagacagcgacgagtcttcccggatctccagg
tcagagaccaccttcagcgacagcagcgcgctgagctcggcgcgcacgtcaaactcgttt
gtgttctgcgggagcaaagccggggctaaactcgcttccgtcttcgacccaaacgagctc
ccgcaaaccgcggcagcttcccgcgtaggagacctcgagagcacctcgctgaacctgtgt
ctcgatgcggccaacaacgccgcgatccccaggggcatcgagggtacgttcgaagcgccc
actggcgcggtctcgctgcgtatggccgccacgctgcgcgaagtgctgttggccacgcgc
gacctcggcctgtctgttccgccgttccccgcggacatgctgagtccccgcgtcttcgcc
gagtacgtgacgcgcgtcgtcaacagcctgaagccgcgcgtgcggcgctccggccagctg
tatctgctgctggggcggctggtgcacttgcgcatcgaaactaaagcggggtcgttccgg
cggtggatggagtctccggatatagacctggaccccaccctgaaaagagacctgcgcgtc
aacgagcgcgctctctgcgaggtcctcggggcctttgccggcggcgcggagtacgccctg
aagaaccgcggactccagtccgccctgaagtacgaagagttctacctcaggccctggggg
aacggtcgcctggagtccgtctcgcagatgtacacgcgcatcgccggagccctggccacg
ggagcccgggagatcccggagatcggaaccgtcgccctggggcgcaccggcgagtggatc
gacctattcgcgtactttttcgacgcgctggtctcccacgcgatcgtgccgtctaccccg
gccatgctgtatctgggcgggcgacagcggtacacgtccagctgctacctggtcaacccg
cagcgcaccgactcggccggcgtgatcgacgccatcacacacaacgtcggcgacatactc
gcgcgacacggcggcataggtctctccatccagtcgtttaacgggggctccagcgtcatg
cccgctctaaagctcttagactccctcgtcgcggcgcacaacgcgggcagtcaccggccc
acaggcgtctgcgtgtacctcgagccgtggcacaccgacgttatggcggtgctgcggatg
cgcgggctgctggccggagaggaggctcgccgctgcgacaacatcttcagcgccatgtgg
atgcccgacctgttcttcaagcgcctcatccgctacatggagggcgagcggggcgtcatg
tggacgctgttcgatggagccgccggcagcgcgctgagcgctcaccacggcgcggagttc
gagcgcctgtacgagaagatggaggaagccggcggctcggcgctcacgcgccttccgatc
caggacttggcgttcgctatcgtccggagcgcggcgtcgacgggcagtcccttcgtcatg
ttcaaggacgcctgcaatcgccactacctgtacgacacgcagggctcggccatctcgtgc
tccaacctgtgcacggaaattgtccacccggcagacgcgcgctccagcggggtctgcaac
ctcgcgagcgtgaacctggccgagtgcgtggaggacggcgcgttcagcttcgagcgcctc
cggcgcgccgtgcgcgcctgcgtgctcatggtcaacgtcatgatcgacacgacccgcacg
ccgaaccagcgctgccagagaggccacgaccgcttgcgctccatgggcatcggcatgcaa
gggctgcacacggcctgcctgcgcctcggcctcgacatgagctcgcctgagtttagagag
ctaaacgcggagatagccgaagtcatgcttctggcagccatgcaggccagcaacgacctc
tgcgtcgccggcctgcccccctttgccgacttcaagcgcagcgtgtacagcgaggggcgc
ttccactgggagggcttcgcgcacgctcgccccaagcactcggacgagtgggcgcggctc
cggcagcgcgtcgtccggcacgggctgcgcaacagccagttcatcgcgctcatgccgacc
gtgtcatcgtcccaggtgtcggagagcagcgagggtttcgcgccggtgttcacgaacatg
tttagcaaggtggggcgggcgggcgagaccctgcgccccaacttgctgttgctggaagcg
gtccacgaagcattcggcggggccgcgctagagcgcgccctggaccgcctggaggacgcg
cagtggtgcgtggcgcgcgcctttccgtgcctggccccggaccacccgctgcggcgcttc
aagacggcgttcgagtacgaccagaccctgctgatcgatctgtgtgctgaccgcgccccc
tacgtcgaccacagtcagtctatgacgctgtacgtcacggaagcctccgacggcactctc
cccgcctccgcgctgactcgcctgctggttcacgcatataagcgcgggctaaagaccgga
atgtactactgcaaagtccgcaaggctactaacagcggagtgtttggcgggagcgaagac
ctggtgtgcactagctgcgtgctgtag

DBGET integrated database retrieval system