KEGG   Vibrio gazogenes: BSQ33_03400Help
Entry
BSQ33_03400       CDS       T04933                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vga  Vibrio gazogenes
Pathway
vga00220  Arginine biosynthesis
vga00250  Alanine, aspartate and glutamate metabolism
vga00290  Valine, leucine and isoleucine biosynthesis
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
vga01130  Biosynthesis of antibiotics
vga01210  2-Oxocarboxylic acid metabolism
vga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSQ33_03400
   00290 Valine, leucine and isoleucine biosynthesis
    BSQ33_03400
   00220 Arginine biosynthesis
    BSQ33_03400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vga01007]
    BSQ33_03400
Enzymes [BR:vga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BSQ33_03400
    2.6.1.66  valine---pyruvate transaminase
     BSQ33_03400
Amino acid related enzymes [BR:vga01007]
 Aminotransferase (transaminase)
  Class I
   BSQ33_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ASA54861
UniProt: A0A1Z2SCL3
LinkDB All DBs
Position
1:754786..756000
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSLKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKKGLRALDVEDVYIGNGASELIVMSMQALLNNGD
EMLVPAPDYPLWTASVSLSGGNAVHYLCDEESDWYPDLEDIKKKITPNTRGIVLINPNNP
TGAVYSRDFLLEFIEIARQHNLIIFADEIYDKILYDGATHTPISTLADDVLMVTFNGLSK
AYRVCGFRGGWMFLTGPKHLAAGYVSGLDILASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWEMINQIPGVSCVKPKGAMYLFPKIDTKMYNIHDDQKMVLDFLIQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFEQFLSTYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatattgggatgtcattaaaacttgataatgtctgctacgacattcggggtcct
gtactcaaacatgctaaacgaatggaggaagagggacataaaatcctaaagctcaatatc
ggcaatccggcaccttttggctttgatgcccctgatgaaatcctcgtcgatgtcattcgt
aatctgccaacatcgcaaggttattgcgactccaaagggatctattctgcccgtaaagcc
gtggtgcagcactatcagaaaaaaggattacgcgccctcgatgtcgaagacgtgtatatc
ggtaacggtgcttctgagctgatcgtcatgtcaatgcaagcgctgttgaataatggcgat
gaaatgttagtaccggcaccggattacccactgtggacggcctcggtctcgctctccggc
gggaatgcggtgcactatctgtgtgatgaagagtcagactggtatcccgatctggaagac
attaaaaagaaaatcaccccgaacacccgcggtattgtactcatcaacccgaataatccg
acaggcgcggtttacagccgtgattttctgttggaatttatcgaaattgcccggcagcat
aatctgattatctttgccgatgagatctacgacaagattttatacgacggcgcaacccat
acaccgatctcaacgctcgctgatgatgtcctcatggtgacattcaacgggctgtcaaaa
gcttatcgtgtttgtggattcagagggggctggatgttcctcacgggtccgaaacatctt
gctgcgggttatgtctccgggctggatatactggcgtcgatgcgcttgtgtgccaatgtg
ccgatgcaacatgcgattcaaaccgcgctgggcggctatcagagtatcaatgaactgatt
ctgcccggtggcagattattagaacagcgcgatcgcgcatgggaaatgatcaatcagatt
ccgggcgtgtcctgcgtcaaacccaaaggggcgatgtatttattcccgaaaattgatacc
aagatgtataacatccacgacgaccagaaaatggtgctcgattttctgattcaggaaaaa
gttttactggttcagggcagcggcttcaactggccgaaacccgaccatttccgtatcgtc
acactgccgcacgttgaagatctggaaattgccatcagtcgtttcgagcagttcctctcg
acttaccgacagtaa

DBGET integrated database retrieval system