KEGG   Vibrio gazogenes: BSQ33_03765Help
Entry
BSQ33_03765       CDS       T04933                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vga  Vibrio gazogenes
Brite
Enzymes [BR:vga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSQ33_03765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASA54924
UniProt: A0A1Z2SCL5
LinkDB All DBs
Position
1:837068..837652
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
SGGIFNNAAQIWNHTFYWHCLSPNGGGEPTGAVADAINQAFGSFEDFKAKFTDSAVNNFG
SSWTWLVKKADGSLDIVNTSNAATPITEAGVTPLLTVDLWEHAYYIDYRNVRPDYMSAFW
ALVNWNFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaacttcccgctcttccttatgcaaaagatgcattggaacctcatatttca
gcagaaacactcgactatcaccatggtaaacaccacaacacatatgtggttaagctgaat
ggcctgatcccaggtacagaattcgaaaacaagtcacttgaagagatcatcaaaacttca
tctggcggcattttcaataacgcggctcagatttggaaccacacattctactggcactgc
ctgtcaccaaacggtggtggtgaaccaacaggtgctgttgctgatgctatcaatcaggcg
tttggttctttcgaagatttcaaagcaaaattcacagattctgctgtcaacaactttggt
tcatcttggacttggttggtgaaaaaagctgatggttctctggatattgtcaatacatcc
aatgcagcaacaccaattactgaagctggtgtaaccccactgctgactgttgacctgtgg
gaacacgcctactacatcgattaccgcaacgtacgtcctgattacatgagtgctttctgg
gctctggttaactggaactttgtggctgaaaatctggcgaagtaa

DBGET integrated database retrieval system