KEGG   Vibrio gazogenes: BSQ33_05540
Entry
BSQ33_05540       CDS       T04933                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
vga  Vibrio gazogenes
Pathway
vga00260  Glycine, serine and threonine metabolism
vga00261  Monobactam biosynthesis
vga00270  Cysteine and methionine metabolism
vga00300  Lysine biosynthesis
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
vga01120  Microbial metabolism in diverse environments
vga01210  2-Oxocarboxylic acid metabolism
vga01230  Biosynthesis of amino acids
Module
vga_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
vga_M00017  Methionine biosynthesis, apartate => homoserine => methionine
vga_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
vga_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSQ33_05540
   00270 Cysteine and methionine metabolism
    BSQ33_05540
   00300 Lysine biosynthesis
    BSQ33_05540
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSQ33_05540
Enzymes [BR:vga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     BSQ33_05540
SSDB
Motif
Pfam: AA_kinase PI-PLC-C1
Other DBs
NCBI-ProteinID: ASA55238
UniProt: A0A1Z2SDL4
LinkDB
Position
1:complement(1209985..1211172)
AA seq 395 aa
MKTPLIVQKFGGTSMGSIERIHTVAKHVIDAKERGQQVVVVVSAMSGETNRLLDLAHQVD
RVPNARELDVILSAGEQASMALLAMTLHKMGYSARSFTGSQLGIMTTNQHNDATILQADT
ARIQQLLDEDTIVIVAGFQGVNEKGDITTLGRGGSDTTAVTLAGMLAADECQIFTDVDGI
YSTDPRIVDNARKLDIIDFPSMEEMSRKGAKVLHLPCVQYAWQHQVPLRVLSTFEQNEGT
LIRGESSQYDVCGIAVQKEMVKLSFESHHIDSILKQCHLLGIDVWNVIGDAEFTALLIKP
DASAKLGLVFEEKIRNSKPVSLLTIVGKKANDLIDSTYQLLCSANILIDSGYSDSLSHSL
VIAPEQIDSATNVVHEAYVISGSFVDHEPKQRFMG
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgaaaactccccttatagttcaaaaatttggtgggacatcgatgggttcgattgaaaga
atccatacggtagcaaaacatgtaattgatgcgaaagagcgtggtcagcaggtggttgtc
gttgtgtcggcgatgtctggtgagaccaatcgattattagatttagcccatcaggttgat
cgggttccaaatgctagggaactggatgtgattttatccgctggagagcaggcatcgatg
gctcttttggcaatgacgctgcataaaatggggtattcagcgcgttcattcacaggttcc
cagcttggtattatgacgacaaatcagcacaatgatgcgacgattctacaagctgataca
gcgagaattcagcagttattggatgaagatacgatcgtgattgttgctggttttcaaggc
gtgaatgaaaagggtgatatcacgaccctgggacgaggcggttctgatacgaccgcggtg
acgcttgccggcatgttggcagcggatgaatgccagatctttaccgatgttgatggcatt
tatagtacggaccccagaattgtcgacaatgcccgaaaactcgatattatcgatttcccg
tcaatggaagagatgtcccgaaaaggtgccaaagtgctccatttgccgtgtgtccaatat
gcatggcaacatcaggttccgttgagggttttatcgacatttgaacagaatgaggggacc
ctcattcgaggggagagctcgcagtatgacgtgtgtggtattgcggtccaaaaagagatg
gtcaagctgagttttgagtctcatcatattgattccattctgaaacaatgccatttatta
ggaattgatgtatggaatgtgatcggggatgcagaattcacagctttactgattaaaccg
gatgctagtgctaagttgggactggtgtttgaagagaaaatccgtaatagtaagccagtt
agcttactgacgattgtcggcaagaaagcgaatgatttgattgattcaacatatcagttg
ctttgttctgccaatattctgatagatagtggttattctgatagcttatctcatagtttg
gtgattgcgcctgaacaaatagatagtgctacaaatgtcgtccatgaagcttatgttatt
tccggttcatttgttgatcatgaacctaaacagcgttttatgggctga

DBGET integrated database retrieval system