KEGG   Vibrio gazogenes: BSQ33_08730Help
Entry
BSQ33_08730       CDS       T04933                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vga  Vibrio gazogenes
Pathway
vga00071  Fatty acid degradation
vga00280  Valine, leucine and isoleucine degradation
vga00281  Geraniol degradation
vga00310  Lysine degradation
vga00362  Benzoate degradation
vga00380  Tryptophan metabolism
vga00410  beta-Alanine metabolism
vga00640  Propanoate metabolism
vga00650  Butanoate metabolism
vga00903  Limonene and pinene degradation
vga00930  Caprolactam degradation
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
vga01120  Microbial metabolism in diverse environments
vga01130  Biosynthesis of antibiotics
vga01200  Carbon metabolism
vga01212  Fatty acid metabolism
Module
vga_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSQ33_08730
   00650 Butanoate metabolism
    BSQ33_08730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSQ33_08730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSQ33_08730
   00310 Lysine degradation
    BSQ33_08730
   00380 Tryptophan metabolism
    BSQ33_08730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSQ33_08730
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSQ33_08730
   00281 Geraniol degradation
    BSQ33_08730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSQ33_08730
   00930 Caprolactam degradation
    BSQ33_08730
Enzymes [BR:vga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BSQ33_08730
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSQ33_08730
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BSQ33_08730
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     BSQ33_08730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ASA55770
UniProt: A0A1Z2SF11
LinkDB All DBs
Position
1:1930034..1932217
Genome map
AA seq 727 aa AA seqDB search
MIFQSKTLQVKEIEGGILELQFCTPQSVNTLDTTTLGYLDKALDTIQDFPGLKGLVLTSD
KDSFIVGADINEFLSLFQYPSDELEQWLHYANQIFCKLEDLPVPTVSALRGYALGGGCEC
VLATDFRVAARSTKIGLPETRLGIMPGFGGCVRLPRLVGADNALEAIVQAKIFNAEHALS
IGLVDAITTEEALFETAKRTLDDAIHCRIDWKKIRQEKCAPLSLSPVESLMVFSTAKGMT
HQKVSTHYMAPFLAIETIESSATLHRDEALNIERKNFVTLAKSDQATALVSIYLNDQYIK
GLAKKAKQSLTHATNHSAVIGAGVMGGGIAYQSAIKGIPAVLKDIVPDSLKLGMDHTTQL
LEQGVKRGKLSPRDMANTLASIRPTLNYTGIEEVDIVVEAVVENPKIKSSVLKELEEKVS
PDTILTSNTSTIPITQLAAELSRPEKFCGMHFFNPVHKMPLVEIIRGKETSEETISAVVA
FAAQMGKSPIVVNDCPGFFVNRVLFPYFLGFCQLLDEGYDFVQIDKIMEKDFGWPMGPAY
LLDVVGIDIAYHAQQVICQAYPERMKASSDNIITRLYEAKKFGQKTGEGFYQYHTDKRGK
SQKVLSPDIYPLVYASEEPLPVTDKQMIMDRMMIPMMNEVILCMEEEIVFSPAEADIALV
YGLGFPPFRGGVCRYLDTIGIAQYIQTAQSYQRLGELYQVPKSLEVMVREARVFYPIHHE
KSASERG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcaatcaaagacattgcaggtaaaggaaatagaaggtggtatccttgagctg
cagttttgcacacctcagtcggtcaatacccttgatacgacaacgttgggctatctggat
aaagcattggatacaatccaagactttccgggacttaaaggcttagtactgacatccgat
aaagacagtttcattgtcggtgccgatatcaatgagtttttaagcttgttccaatatcca
agtgatgagttggagcaatggcttcactatgccaaccaaatattctgtaaacttgaagat
ctgccggtaccgacagtttcagcactacgcggatatgcccttgggggtggatgtgagtgt
gtactcgcaaccgattttcgtgttgcagcgcgatcaacaaaaataggcttacccgaaaca
aggctcggaattatgcccggatttggcggctgtgttcgtctgccaaggttagtgggtgca
gataacgccttagaagcgattgttcaggctaagatatttaatgctgaacatgccctatcc
atcgggttggtcgatgcgatcacaaccgaagaagcacttttcgaaacagcaaaaagaacg
ctggatgatgccattcactgtcggattgactggaaaaaaatacgtcaggaaaaatgtgca
ccactttctttatcacccgtcgaaagcttgatggtcttttctacagccaagggaatgact
caccaaaaagtgagcactcactacatggcacctttcttggcgattgagaccattgaatct
tcagccactctgcaccgagatgaagcgctcaatattgaacggaagaactttgtcacactc
gcgaaatcagatcaggcaaccgctctggtcagtatttatctcaatgatcaatatattaaa
ggtctcgctaaaaaagccaaacagtcacttacccatgccaccaaccatagtgcagtgatt
ggtgctggcgtgatgggtggcggtatcgcttatcagtccgcaataaaaggcatcccagcc
gttttaaaagatatcgttcctgactctctaaaattgggaatggatcatacgacccaattg
ttagagcaaggcgttaagagaggcaaactgtccccgagagatatggccaacacgcttgca
tcgattcgcccgacactcaactataccggtatagaagaagtcgatatcgtggttgaagcc
gtggttgaaaaccctaaaatcaaatcgtcagtcctgaaagagctggaagaaaaagtctcg
ccagataccattctgacgtcaaacacctcgacaattccgattacccaattagctgccgaa
ctctcaagacctgaaaaattctgtggcatgcattttttcaatccggtgcataaaatgccg
ctggttgaaattatccgcggtaaagaaaccagtgaagaaacgatttcggctgtggttgct
tttgcagctcagatgggaaaatcgcctattgtcgtcaacgattgccccggattttttgtc
aatcgcgttctgtttccttattttctgggcttttgtcagttacttgatgaaggatatgac
ttcgtccagattgataaaatcatggaaaaagattttggttggccaatggggccggcctac
ttgcttgatgtcgtcggtatcgacattgcgtatcacgctcagcaagtgatttgccaagct
tatcccgaaaggatgaaagcatcctcggataacattattacccgactttatgaggcgaag
aaattcggtcagaaaaccggtgaaggcttctatcagtaccatacggataaacggggcaaa
agccagaaggttttatcaccggatatttatccgcttgtctatgcatcggaagagccacta
ccagtgacggataagcaaatgattatggatcgcatgatgattccgatgatgaatgaagtg
attctctgtatggaagaagagattgtcttctcacccgcagaagcagacattgctctcgta
tacgggctcggtttcccgccattcagaggcggtgtttgtcgctatctggataccattggt
attgcacaatatattcaaactgctcagtcataccagcgtttaggagaactctatcaggtt
ccgaaatctctcgaagttatggttcgtgaggccagggttttctatcctatccaccatgaa
aaatcagcatcagagagagggtaa

DBGET integrated database retrieval system