KEGG   Vibrio gazogenes: BSQ33_11650Help
Entry
BSQ33_11650       CDS       T04933                                 

Definition
(GenBank) xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
vga  Vibrio gazogenes
Pathway
vga00040  Pentose and glucuronate interconversions
vga00053  Ascorbate and aldarate metabolism
vga01100  Metabolic pathways
vga01120  Microbial metabolism in diverse environments
Module
vga_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSQ33_11650
   00053 Ascorbate and aldarate metabolism
    BSQ33_11650
Enzymes [BR:vga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     BSQ33_11650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ASA56285
UniProt: A0A1Z2SGM3
LinkDB All DBs
Position
1:2548022..2548891
Genome map
AA seq 289 aa AA seqDB search
MNNHTLKSRIGLYEKAMPATLSWEDRLREAKSLGFDFVEISVDETDARQQRLDWGDDEIE
QLRQLCFQYDIPLQSMCLSAHRKFPFGSEHPQVREKAREIMEKAIKLAYRLGIRTIQLAG
YDVYYESQSVETHQRFIDGMRWAAKLAEQAGVMLAVEIMDTPYLNSLSKFEVLKREVPSP
YFMAYPDVGNITGWNHDVCTELKLARDHLVQIHLKDTLKVKHGFSGKFRDLVIGEGEVDF
PAIFTALKEIHYGAPFVIEMWAHDEHWRDNIITAKQRLTEMAHSVGFEL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccataccctcaaatctcgcatcggcttatatgaaaaggcgatgccggcaacg
ctatcctgggaagatcgtctcagagaagcgaaatcacttggcttcgattttgtcgaaatt
tctgtcgatgaaaccgatgctcggcaacaacggctggactggggagatgatgagattgaa
cagcttcgtcagctctgttttcagtacgacataccattacaaagcatgtgtttgagtgcg
caccgtaagttcccattcggctctgaacatccacaggttcgcgaaaaagcccgtgagatt
atggaaaaagccatcaaactggcttatcgactggggatccgaaccattcaattggccgga
tatgatgtctattatgagtctcaatcggtagagacccatcagcgttttattgacggcatg
cgctgggcagcgaagctggcagagcaggcgggtgtgatgctggcagtcgaaattatggac
acgccctatctgaattcgttatctaaatttgaagtcttaaaacgcgaagtcccgtcccct
tattttatggcttatcccgatgtcggtaatatcacgggctggaatcacgatgtttgtacc
gagctgaaactggcccgggatcatctggtgcagattcaccttaaagatacgctgaaagtg
aaacatggtttctccgggaagttccgggatttggtgatcggtgaaggcgaagttgatttt
ccggccatttttacggcactcaaagagattcactacggtgcgccgttcgtgattgagatg
tgggctcatgatgagcactggcgagacaatatcatcaccgccaaacagcgtttaacagag
atggcacatagcgtcgggtttgagttatag

DBGET integrated database retrieval system