KEGG   Vibrio gazogenes: BSQ33_15645Help
Entry
BSQ33_15645       CDS       T04933                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vga  Vibrio gazogenes
Pathway
vga00250  Alanine, aspartate and glutamate metabolism
vga00410  beta-Alanine metabolism
vga00430  Taurine and hypotaurine metabolism
vga00650  Butanoate metabolism
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
vga01120  Microbial metabolism in diverse environments
vga02024  Quorum sensing
Module
vga_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSQ33_15645
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSQ33_15645
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSQ33_15645
   00430 Taurine and hypotaurine metabolism
    BSQ33_15645
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSQ33_15645
Enzymes [BR:vga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSQ33_15645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446 DUF1319
Motif
Other DBs
NCBI-ProteinID: ASA56989
UniProt: A0A1Z2SIH2
LinkDB All DBs
Position
1:complement(3444081..3445733)
Genome map
AA seq 550 aa AA seqDB search
MVVKSKTAQANFDSLLRIFTIPEGPGSTLTQIEEEISQNLNQFLREHIVSEEKPLKTIEQ
DFLSSQIPEQPTFVSEHTQHLLDKVVAQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVIGMLHRLIYTGNEEFYTQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKAQGTFQGVEQEGLFRAMQHYGYEGLAILVSERGHYSLKKAADLLGIGQQG
LVVIPTDEHNRIIPDELKATIQRLKQQQILPFSVVGVAGTTETGNIDPLAEMAAICQQEQ
CHFHVDAAWGGATLMSNQYRHLLNGIEQADSVTIDAHKQLYLPMGAGMVIFKSPTSSHAI
EHHAQYILREGSKDLGSRTLEGSRSGMAMLVYACMHIISRAGYELLINESIQKAAYFADL
IGQQDDFELVSEPELCLLTYRYVPHQARLALQHCTGDTLAQLNQQLNALTKFIQKKQRES
GKSFVSRTQLTPKRWQHLNTIVFRVVLANPLTTKDILHAVLEEQRHIATLAPTLLRQIQR
SAENILSGNI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaaaagcaaaacagcgcaagccaattttgatagcctgcttcgaattttcacc
ataccggaaggtccggggtccacgctgacccaaatcgaagaagagatctctcagaacctc
aatcagttcttacgagagcatatcgtttccgaagaaaaaccgctgaaaaccattgagcaa
gattttctttcttcacagattccggaacaaccgacatttgtctctgaacatacccaacat
ttgctggacaaagtcgtcgctcagtcggttcatacatcggctcccagctttatcggtcat
atgacatcggcgctgccctattttctgatgccgctgtcaaaaatcatgattgcgctgaac
caaaacctcgtcaaaattgaaacctcgaaagccttcacaccactcgaacgtcaagtcatc
ggcatgttacaccgactgatctatacgggtaatgaagagttctatacgcagtggatgcac
agtgccaaccattcactgggagcattttgctcaggcggaaccattgccaatatcacggcc
ttatgggtcgcccgcaataatgcgctcaaggctcagggtacatttcagggcgttgagcag
gaaggtctgttccgagccatgcaacattatggctatgaggggttagcgattctggtctca
gaacgcggtcattattcgttaaaaaaagcagcagatttactgggaatcggtcagcaaggt
ttagttgtcattccgacggatgaacataatcgaattatacccgacgagctaaaagcaacc
atccaacggttgaagcaacaacagattttgccattttcagtcgtcggtgtcgccggaaca
acggaaacaggcaatatcgacccacttgctgaaatggctgcaatttgtcagcaggaacag
tgtcatttccatgtcgatgcagcatggggtggtgcaacattgatgtcgaatcaataccgt
catctgttaaacggtatcgaacaagccgattcagtgaccatcgatgcgcataaacaactc
taccttccaatgggcgctggaatggtgatatttaaatcacccacatcaagccatgcgatt
gagcaccatgcccaatatattcttcgcgaaggctcgaaagatttaggtagccggacactc
gaaggttcccgctccggcatggcaatgttggtttatgcatgtatgcatatcatcagtcgt
gcgggttatgaattgctgatcaatgaaagtattcaaaaagcggcttattttgccgatctt
attggtcagcaggatgactttgaactcgtttcagaacctgagttgtgtttattgacttat
cgttacgttcctcaccaagcacgtcttgccttgcaacactgcactggtgatacacttgcc
caactcaatcaacaattgaatgcactgacaaaattcattcagaaaaaacaaagagaatca
ggaaagtcatttgtttcccgaacgcaactgacacccaagcgttggcagcatctcaatacc
attgttttccgcgtcgtgcttgccaacccgttaaccaccaaagatatattacatgcagtt
ttagaagagcagcggcatattgctacgctcgccccgacattactgcgccaaatccaacgc
tcagcagaaaacattctgtcaggcaacatataa

DBGET integrated database retrieval system