KEGG   Vibrio gazogenes: BSQ33_16930Help
Entry
BSQ33_16930       CDS       T04933                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
vga  Vibrio gazogenes
Pathway
vga00260  Glycine, serine and threonine metabolism
vga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSQ33_16930
Enzymes [BR:vga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BSQ33_16930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_2 Pyr_redox_3 AdoHcyase_NAD FAD_oxidored FAD_binding_2 FMN_dh 2-Hacid_dh_C Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ASA58274
UniProt: A0A1Z2SM78
LinkDB All DBs
Position
2:270101..271132
Genome map
AA seq 343 aa AA seqDB search
MKIKALSKLKPEQGIWMTSVDMPVMGHNDLLIKIKKTAICGTDVHIYNWDEWSQKTIPVP
MVVGHEYVGEVVGIGQEVRGFSIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRT
GAFAEYLVIPAYNAFKIPDGISDDLAAIFDPFGNAVHTALSFDMVGEDVLITGAGPIGIM
AAAVAKHVGARHVVITDVNPYRLQLAEKMGVTRAVNIAEERLNDVMAELGMTEGFDVGLE
MSGVPAAFHTMLEAMNHGGRIALLGIPPSDMAIDWNQVIFKGLVIKGIYGREMFETWYKM
ASLIQSGLDLTPIITHHYKIDDFQKGFDVMRSGASGKVILDWE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaagcattatcaaagctaaaacctgagcagggtatttggatgacctcggtc
gatatgccagttatggggcataatgacctgctgatcaaaattaagaaaacggcgatttgt
ggtactgatgtccacatttataactgggatgagtggtcgcaaaaaacgattcctgtgccg
atggtggtcggccatgaatatgtgggtgaagtggtgggcattggtcaggaggtccgcggt
ttctctattggtgatcgggtttccggagaaggtcatattacctgtggtcactgccgcaat
tgtcgtggtggcagaacacatttatgtcgcaataccattggtgttggtgtgaaccggacg
ggagcatttgccgagtatctggttattccggcttacaatgcgttcaaaataccagatggc
atttccgatgatctggctgcgatttttgatccgttcggcaatgcggtacatacggcgctg
tcgttcgatatggttggggaggatgtgttgatcactggtgccggaccaattggcattatg
gctgccgccgttgcaaaacatgttggtgctcgccatgtggtgatcacggatgttaatccg
tatcgcctgcaattggctgagaaaatgggtgtcactcgtgctgtcaatattgcagaagag
cggctcaatgatgtcatggcagaactgggaatgaccgaaggatttgatgttggtttagaa
atgtccggtgttccggctgcatttcacacgatgttagaagccatgaatcacggtggacga
attgctctgttggggatcccaccatcggatatggcaatcgactggaatcaggtcattttt
aaaggtttggttatcaaagggatttacggtcgggaaatgttcgaaacttggtacaagatg
gcaagcctgatccaatccggcctcgatctgacgccaattatcacccatcattacaaaatt
gatgatttccaaaaaggcttcgacgtcatgcgcagcggggcttccgggaaagtgattctt
gattgggaataa

DBGET integrated database retrieval system