KEGG   Vibrio gazogenes: BSQ33_17060Help
Entry
BSQ33_17060       CDS       T04933                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vga  Vibrio gazogenes
Brite
KEGG Orthology (KO) [BR:vga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSQ33_17060
Enzymes [BR:vga01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSQ33_17060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Glutaredoxin DAO FAD_binding_2 Thioredoxin_9 AlaDh_PNT_C FAD_binding_3 Thi4 PG_binding_4 DUF5474 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASA57469
UniProt: A0A1Z2SJX3
LinkDB All DBs
Position
2:complement(302700..304268)
Genome map
AA seq 522 aa AA seqDB search
MLDQAIKQQLKQYLTNLKEDVRLVVSLDESKASQEILSLAEEIETLSDRVSVVHDNAASE
RKPVMAVTNPEKGTQLRFAGVPMGHEFTSLVLALLHSGGHPMKLEDETITQIASLHKKLD
VEIFISLSCQNCPDVVQAFNMMAAINPDIRVTMIDGALFQDEVKQRDILAVPSVFVNGEL
FGQGRMSLAEILTKIDDGAAERAAASINEKDPYDVLVVGGGPAGGAAAVYAARKGIRTGI
VAKRLGGQVMDTMAIENFISVKRTEGPKLAADLGEHLKEYDVDLITDQQADRLMGAAYTE
DGYIHVNLESGATLKSKSVILSPGARWREMNVPGEHEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNIDIITMAQTTEVIG
DGKRVTGLKYKDRHTDEIHTLLLSGIFVQIGLVPNTEWLKDSDVTLSPRGEIEVGSRGDT
SMSGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRHQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccaagcgatcaaacaacaattaaaacaatatctcacaaacttaaaagaagat
gtccgcttagtggtcagtctagatgaaagtaaagcatctcaagaaattctttcactggct
gaagagatcgaaacattaagcgatcgtgtctcggtagtgcatgataacgcggccagtgaa
cgtaaacccgtcatggcggtcactaacccggagaaaggtacacaattgcgttttgccggt
gtgccgatgggacacgaatttacttcattggtattagcgctgctccactcgggtggtcat
ccgatgaaacttgaagacgaaaccatcacacagattgccagtctgcataaaaaactggac
gtggaaatctttatttcgctttcgtgccagaactgtcctgatgtggttcaagctttcaac
atgatggcagcaatcaacccagacattcgtgtcaccatgattgatggcgccctgttccaa
gatgaagtcaaacaacgcgatattctggcggtgccaagcgttttcgtaaatggtgagtta
tttggccaaggtcggatgtcactggcagaaatcttaaccaaaattgatgatggtgcagca
gaaagagcagcagccagtattaacgaaaaagacccatacgatgtattggtcgtcggtggc
ggacctgccggtggtgctgcggctgtttatgccgctcgtaaaggcatccgaaccggtatc
gttgcgaagcgtctcggtggtcaggtgatggacaccatggcaattgaaaactttatttct
gtcaaaagaacggaaggcccgaaactggcagccgatttgggtgaacatctcaaagagtat
gatgtggatctcatcacggatcagcaagccgatcggctgatgggtgctgcttataccgaa
gatggatatattcacgtcaaccttgaaagcggtgcaacactcaagagtaaaagtgtcatt
ctcagcccgggcgcacgctggagagaaatgaatgttcccggtgaacatgaataccgcaat
aaaggggtggcttattgccctcactgtgatggcccactgtttaaaggcaagaaaacagcc
gttatcggtggcggcaactccggtattgaagccgcaattgatttagccgggattgtcgaa
cacgttacggtccttgaatttgccgatgtacttcgagcagatcaagtgctgattgataaa
gcaaactccctgccgaacatcgatatcatcacgatggcacagacaaccgaagtgatcggt
gatgggaaacgggtgaccggtcttaaatataaagatcgtcatactgatgagatccatacc
ctgttgttgtccggtatttttgtacagattggtttggtacccaataccgaatggctaaaa
gattcagatgtgacactgtcaccaagaggtgagattgaagtcggtagccggggcgatacc
agtatgtcaggtgtttttgctgccggagatgcgacgactgtcccttataaacagatcatt
atcgcgatgggcgaaggggcgaaagccagtctgggggcatttgattacctgattcgtcat
cagggctga

DBGET integrated database retrieval system