KEGG   Vibrio gazogenes: BSQ33_17420Help
Entry
BSQ33_17420       CDS       T04933                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vga  Vibrio gazogenes
Pathway
vga00473  D-Alanine metabolism
vga00550  Peptidoglycan biosynthesis
vga01100  Metabolic pathways
vga01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSQ33_17420
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSQ33_17420
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSQ33_17420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vga01011]
    BSQ33_17420
Enzymes [BR:vga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSQ33_17420
Peptidoglycan biosynthesis and degradation proteins [BR:vga01011]
 Precursor biosynthesis
  Amino acid ligase
   BSQ33_17420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: ASA57535
UniProt: A0A1Z2SK74
LinkDB All DBs
Position
2:complement(387255..388271)
Genome map
AA seq 338 aa AA seqDB search
MGRINILLLCGGGSSEHEVSLVSANYVQEQLQTNPHFDVERIEMTPDGWLTEDGHLAYLD
TNTATLNTDVSRQKIDFVVPCIHGYPGETGDIQSMLELAAIPYLGCGPEASSNSFNKITS
KLWYDALGVPNTPYLFLSEFTDQTVEQCEDALHRWGALFVKAARQGSSVGCYKVTDLAQL
RQSVTSAFQFSEQVLVEQAVKPRELEVAAYEIGGELHISAPGEVIAPADAFYTYEEKYSQ
TSHSYTKVEAEGLTAKQLASIREYSEKVFRHMKLRHLARIDFFLTSDGHIYLNEVNTFPG
MTPISMFPKMLENNGHHMADFLTDCIERSLEQVTTSKA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtatcaatatattattgctttgtggtggtggttcatcagaacatgaggtgtca
ttggtttctgcgaattatgttcaggaacagctccaaacgaatcctcactttgacgtcgaa
cgtattgaaatgacacctgacgggtggttgaccgaagatggccatctggcatatctggat
accaatacagcgacactgaatactgatgtcagtcgtcagaaaattgattttgtggtgccc
tgtatccatggttatcccggagagaccggtgatattcagtcgatgcttgaattagcagcc
attccatatctgggatgtggtcccgaagcgagttcaaatagctttaataaaattacctcg
aagctttggtatgatgcgttaggcgtgcctaatacgccttatttattcctgtctgaattc
acagatcaaacggttgaacaatgtgaagacgcattgcatcgttggggagccttatttgtc
aaagctgcgcgacaaggttcttcagttggttgttacaaggtcactgatttggcgcaatta
cgccagtcggtcacctcggcatttcagttttcggaacaggttctcgttgaacaagcagtg
aagccgagagagctagaagtcgctgcttatgaaatcggtggggaacttcatatctcggct
cccggtgaggtcattgctccggctgatgctttttacacctatgaagagaaatatagtcaa
accagccattcctataccaaagttgaggctgaaggtttgactgctaaacagcttgcttcc
attcgtgaatacagcgagaaagtattccgtcatatgaaacttcgacatcttgctcggatt
gattttttcttgacctcagatggacatatctatttgaacgaagtgaatacattcccggga
atgacgcccatctcaatgttcccaaaaatgttggaaaataatggccatcacatggcggat
ttcttaacggattgtattgaacgttcattagaacaagttacgacttccaaggcttaa

DBGET integrated database retrieval system