KEGG   Variibacter gotjawalensis: GJW-30_1_01849
Entry
GJW-30_1_01849    CDS       T05320                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vgo  Variibacter gotjawalensis
Pathway
vgo00473  D-Alanine metabolism
vgo00550  Peptidoglycan biosynthesis
vgo01100  Metabolic pathways
vgo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vgo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GJW-30_1_01849 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GJW-30_1_01849 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GJW-30_1_01849 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vgo01011]
    GJW-30_1_01849 (ddlB)
Enzymes [BR:vgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GJW-30_1_01849 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:vgo01011]
 Precursor biosynthesis
  Amino acid ligase
   GJW-30_1_01849 (ddlB)
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A ATPgrasp_TupA
Other DBs
NCBI-ProteinID: BAT59318
UniProt: A0A0S3PTN8
LinkDB
Position
1893423..1894343
AA seq 306 aa
MAKHVAVLFGGWSSEREVSLRSGASCAKAAEERGYRVTRIDVDRNIAAVLADVKPDVVLN
VLHGRPGEDGTLQGILEVMQIPYSHSGVLASSVAMQKDVAKDMFRAKGIPVPHGSVVSRF
DAAKEHLLPRPYVLKPIAEGSSVGVFIVREDQEHPPQELYRDDWKFGDLILCEKFIPGRE
LTCAVIGDRALEVTEIVPTVRFYDYEAKYADGGSKHIVPAQILPNVYQEARRLAAAAHNA
LGCRGVSRTDFRYDDSVGGTAGLYCLEVNTQPGMTETSLVPELAAYAGISFGELVQWMIE
DASLNR
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcgaagcacgttgcggttcttttcggcggatggtcgtccgagcgggaggtttcgctg
agatcgggcgcctcctgcgccaaggccgccgaagagcgcggctatcgcgtcacccgcatc
gatgtcgaccgcaacatcgcggccgttttggccgacgtaaagccggatgtggtgctcaat
gtgctgcacggccgtccgggcgaggacggcacgctgcagggcatcctcgaagtcatgcaa
attccttactcgcattccggcgttttggcctcgtcggtggccatgcagaaggatgtcgcg
aaggacatgttccgcgccaaggggattccggtccctcacggcagcgtcgtctcgcgtttc
gatgccgccaaggagcatctgctgccgcggccctacgttctcaagccgatcgccgaaggt
tcgagcgtcggcgtcttcatcgtccgcgaggatcaggaacatcctccgcaggagctctat
cgggacgactggaagttcggcgatttgattctctgcgagaagttcatcccgggccgagaa
ttgacctgtgcggtcatcggagacagggccctggaggtcaccgagatcgtcccgacggta
cgcttctacgattacgaggcgaaatacgccgacggcgggtccaaacacatcgtgcccgct
caaattttaccaaatgtttaccaagaggcccgaagactggcagcggcggcgcacaatgcg
ctcggatgccgcggtgttagtaggaccgatttccggtacgacgacagcgtgggggggacg
gcgggactttattgcctcgaagtcaacacccagcccggcatgaccgagacgtcacttgtg
cccgaattggcggcgtatgcaggtatttcgttcggtgagctggttcaatggatgatcgag
gacgcctcgctcaaccgctga

DBGET integrated database retrieval system