KEGG   Variibacter gotjawalensis: GJW-30_1_03634Help
Entry
GJW-30_1_03634    CDS       T05320                                 

Gene name
tuf_2
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
vgo  Variibacter gotjawalensis
Brite
KEGG Orthology (KO) [BR:vgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:vgo03012]
    GJW-30_1_03634 (tuf_2)
   03029 Mitochondrial biogenesis [BR:vgo03029]
    GJW-30_1_03634 (tuf_2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vgo04147]
    GJW-30_1_03634 (tuf_2)
Translation factors [BR:vgo03012]
 Eukaryotic Type
  Elongation factors
   GJW-30_1_03634 (tuf_2)
 Prokaryotic Type
   GJW-30_1_03634 (tuf_2)
Mitochondrial biogenesis [BR:vgo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GJW-30_1_03634 (tuf_2)
Exosome [BR:vgo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GJW-30_1_03634 (tuf_2)
  Exosomal proteins of breast cancer cells
   GJW-30_1_03634 (tuf_2)
  Exosomal proteins of colorectal cancer cells
   GJW-30_1_03634 (tuf_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAT61083
UniProt: A0A0S3PYV4
LinkDB All DBs
Position
complement(3697889..3699079)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAEKGGATFTAYDQIDKAPEEKARG
ITISTAHVEYQTDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLELVELEVRELLSKYEFPGDDIPITKGSALCALE
DREPKIGREAVLALMETVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGLRATTKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVVPGDNVA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagagaaatttgaacgcaataagccgcactgcaacatcggcacgattggtcac
gtcgaccatggcaagacgtcgttgacggcagcgatcacgaaggtgttggcggagaagggc
ggcgcaacgttcacggcgtacgaccagatcgacaaggcaccggaagagaaggcacgcggc
attacgatctcgaccgcacacgtcgagtatcagaccgacaaccgccactatgcgcacgtc
gattgcccgggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctcgtcgtgtcggctgccgacggcccgatgccgcagacgcgtgagcacatc
ctgctcgcccgccaggtcggcgttccggcactcgtcgtgttcatgaacaaggtcgacatg
gtcgacgatccggagctgctcgagctcgtcgagctcgaagtgcgcgagctgctctcgaag
tacgagttcccgggcgacgacattccgatcaccaagggttcggcgctgtgcgcgctcgaa
gaccgcgagccgaagatcggccgtgaagccgtgctggcgctgatggaaaccgtcgatgct
tacatcccgcagccggagcgcccgatcgaccagccgttcctgatgccggtcgaagacgtg
ttctcgatctcgggccgcggcacggtcgtcaccggccgcgtcgagcgcggcatcgtcaag
gtcggcgaggaagtcgagatcgtcggcctgcgcgcgacgacgaagacgaccgtcacgggc
gtcgagatgttccgcaagctgctcgatcaaggccaggccggcgacaacatcggcgcgctg
ttgcgcggcacgaagcgcgaagacgtcgagcgcggccaggttctctgcaagccgggttcg
gtcaagccgcacacgaagttcaaggcagaagcctacatcctgacgaaggatgagggcggc
cgccacacgccgttcttcacgaactaccgtccgcagttctacttccgcacgacggacgtg
acgggcgtcgttcacctgccggaaggcaccgagatggtcgttccgggcgacaacgtcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctccgcttcgccatccgc
gaaggcggccgtacggtcggcgccggcgtcgtcgcaagcatcatcgagtga

DBGET integrated database retrieval system