KEGG   Variibacter gotjawalensis: GJW-30_1_03662Help
Entry
GJW-30_1_03662    CDS       T05320                                 

Gene name
fabZ_2
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vgo  Variibacter gotjawalensis
Pathway
vgo00061  Fatty acid biosynthesis
vgo00780  Biotin metabolism
vgo01100  Metabolic pathways
vgo01212  Fatty acid metabolism
Module
vgo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vgo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GJW-30_1_03662 (fabZ_2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GJW-30_1_03662 (fabZ_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vgo01004]
    GJW-30_1_03662 (fabZ_2)
Enzymes [BR:vgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     GJW-30_1_03662 (fabZ_2)
Lipid biosynthesis proteins [BR:vgo01004]
 Fatty acid synthase
  Component type
   GJW-30_1_03662 (fabZ_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: BAT61106
UniProt: A0A0S3PYW8
LinkDB All DBs
Position
3722017..3722487
Genome map
AA seq 156 aa AA seqDB search
MNLEYFQLIDRIVDLSLPERRITVEARVPETSTIFEGHFPGHPLMPGVLLIESMAQSSGW
LVIAAGGFKQMPFLAQVKEAKLRTFVSPGALLRLEAELIHEGSGFAVTKVKVTQDGKAIC
NSELVFRVVDFPNDEMRGKMRETAERIAFPMGMINA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgagtacttccagctcatcgaccgcatcgtcgatctgtcgctcccggagcgc
cggatcacggtcgaggcgagggtcccggaaaccagcacgattttcgaaggccacttcccg
ggtcatccgttgatgccgggcgttctcttgatcgagtcgatggcgcagtcgtccggctgg
ctggtgatcgccgccggcggcttcaagcagatgccgtttctcgcacaggtgaaagaagcc
aagctccgcaccttcgtgtcgcccggcgccctgctccgcctcgaagccgagctgatccac
gaaggctccggctttgcggtgacgaaagtgaaagtcacgcaggacggcaaggcgatttgc
aattcggaactcgtcttccgcgtcgtcgactttccgaacgacgagatgcgcggcaaaatg
cgcgagactgcggagcgcatcgcgttcccgatggggatgatcaatgcctga

DBGET integrated database retrieval system