KEGG   Variibacter gotjawalensis: GJW-30_1_04000Help
Entry
GJW-30_1_04000    CDS       T05320                                 

Gene name
nicR_2
Definition
(GenBank) HTH-type transcriptional repressor NicR
Organism
vgo  Variibacter gotjawalensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 Replic_Relax HTH_Crp_2 GntR TrmB HTH_24 PadR DUF505 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: BAT61443
UniProt: A0A0S3PZX0
LinkDB All DBs
Position
4072713..4073204
Genome map
AA seq 163 aa AA seqDB search
MVEGERPETKAVDAVDGNVPDWPLGERPGFLVRRLHQIHVSLFAELCADAKITPLQFSLL
SALSDCLVADQSTLASMIALDRTTTTGALKRLEARGLVRRANSPTDRRAQLCQLTTEGER
LLRAMEDAARRAHAETISPLSAKEQEQFVSFLKRIVAAHDSRL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggttgagggcgagagacccgagacgaaggctgttgatgcggtggatggcaatgtgccg
gactggccgctcggcgagcggccgggattcttagtccgccgccttcaccagatccacgtc
agcctgttcgccgaactctgcgcggacgcgaagatcacgccgctgcagttcagcttgctc
tcggccctctccgattgtcttgtcgccgatcaatcgactctcgcttcgatgatcgcgctt
gaccgcacgacgacgaccggcgctctgaaacgcctcgaagcacgcggactcgtccgccgc
gcaaactcgccgaccgatcggcgcgctcagctctgccaactgaccaccgagggcgaacgg
ctgttgcgcgcaatggaagatgcagcacgccgcgcgcatgccgaaaccatctcgccgctg
agcgcaaaggaacaggagcagttcgtgtcgttcctcaagcgcatcgtcgcggcccacgac
agccggctgtga

DBGET integrated database retrieval system