KEGG   Vibrio campbellii: VIBHAR_00045Help
Entry
VIBHAR_00045      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vha  Vibrio campbellii
Pathway
vha00620  Pyruvate metabolism
vha00680  Methane metabolism
vha01100  Metabolic pathways
vha01120  Microbial metabolism in diverse environments
vha01200  Carbon metabolism
Module
vha_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_00045
  09102 Energy metabolism
   00680 Methane metabolism
    VIBHAR_00045
Enzymes [BR:vha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VIBHAR_00045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF349
Motif
Other DBs
NCBI-ProteinID: ABU69105
UniProt: A7MXA7
LinkDB All DBs
Position
I:44193..46859
Genome map
AA seq 888 aa AA seqDB search
MDVVFLRGRMTMNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGN
SADRESLIEEIKSLPDEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLF
SKLVQNDVSKLDTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSFK
ERKKTERRLEQLIVQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLK
SYLGEGLPIDARPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISE
LSMTVCNDKVRELAGEDQHEPYRAILKQLRSLLNETKDILDAKVHGQKLAVKAPLQKVEQ
LWEPLYACYQSLNECGMGVIANGSLLDTLRRVKAFGIHLVRLDIRQESTRHADVLSELTR
YLGIGDYEQWSEQDKIAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIVAAQPREAFGA
YVISMARTASDVLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAEAVIKQLMGIDLYRGFI
QNHQMVMIGYSDSAKDAGVMSAGWAQYHAMDSLVKVAEEEGVELTLFHGRGGTIGRGGAP
AHAALLSQPPKSLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQ
EWRDLMDVLSEVSCESYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVES
LRAIPWIFSWSQNRLVLPAWLGAGEAIQYSVDKGHQALLEEMCREWPFFSTRLGMLEMVY
TKCNMDISRYYDQRLVDEPLQPLGDRLREQLQRDIKSVLNVENNENLMQSDPWGLESIRL
RNIYVEPLNMLQAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagtttttttacgaggcaggatgacaatgaacgagaaatacgccgcactcaaa
agtaatgtgcgcatgttgggccaccttctgggtaacacgattcgtgatgctcatggcgaa
gaaatcttcgagaaagtggaaaccattcgtaaattatccaaatcggctcaagctggaaat
agcgctgacagagaaagcttaatagaagaaattaaaagcttgccagatgagcaattgacg
cccgttactcgcgcgttcaaccaatttctaaacctgaccaatattgctgagcaataccac
accatttcacgccactgtgaagagcatatctgcgaacctgacgcaattaactcgctgttc
tcaaagctggtgcaaaatgatgtaagcaagttagacacggcacaagcggttcgtgacctg
aacattgaattagttctcactgcgcacccgaccgaaatcactcgtcgcaccatgatcaac
aaactggtgaagatcaacgagtgcctatctaagctagagctgagcgatctctctttcaaa
gagcgtaaaaaaactgaacgtcgccttgagcagctgatcgttcaaagctggcactctgac
gttattcgtcagcagcgacctacaccgcttgatgaagctaaatggggctttgcggttgta
gaaaactcactatgggaagccgtgcctgacttcctacgtgaaatgaacgaccgcctgaaa
tcttaccttggcgaaggtctaccaattgatgctcgccctgtgcacttctcatcttggatg
ggcggtgaccgcgacggtaacccatttgtgacccacagtgtgactcgtgaagtactactt
ctgtctcgttggaaagcggcagacctataccttaacgacatcaacgagctgatcagcgaa
ctgtctatgacagtgtgcaacgacaaagttcgtgagcttgcgggtgaagatcaacacgaa
ccataccgtgcgatcctaaaacagctacgttcactactgaacgaaaccaaagatattctc
gacgcgaaagttcacggccagaagctggcagtcaaagcacctctgcaaaaagtagagcaa
ctttgggaaccactttacgcgtgttaccagtcgctaaacgaatgtggcatgggcgtgatt
gccaacggctcactgctggatacgctgcgccgcgttaaagccttcggtatccacctagtt
cgcctcgatattcgtcaagaaagtactcgtcatgctgacgtgctttctgaattgactcgt
tacctaggcattggtgactatgagcagtggagcgagcaagacaagatcgctttcctaacc
aacgaacttgcgtctaagcgccctcttctacctcgtgactgggagccatcagaacccgtt
aaagaggttttggatacctgtaagattgttgccgcacaacctcgtgaagcgtttggagct
tacgttatctcaatggcacgtaccgcttctgacgtacttgccgtgcacctactgctgcaa
gaagcaggttgcccttaccgcatggacgtatgtccactgttcgaaacgctagacgacttg
aacaacgcggaagcggttatcaaacagctgatgggcatcgacctataccgtggctttatc
cagaaccaccaaatggtgatgatcggctactctgactctgcaaaagatgcaggtgtaatg
tcagcaggttgggcgcaataccacgcgatggactcactggttaaggttgcggaagaagaa
ggcgttgaactcacactgttccacgggcgtggcggtacgattggtcgtggtggcgctcca
gcacacgctgcactattgtctcaaccacctaagagtctgaaaggcggtctgcgcgtaaca
gaacaaggtgagatgatccgctttaagctgggtctacctgatgttgccgttaacagcttc
aacctgtacgcaagtgcaatccttgaagcaaacctactgccaccaccagagcctaagcaa
gagtggcgtgatctaatggacgtgctgtcagaagtgagctgtgaatcttaccgcagtgtc
gttcgtggcgaaccagacttcgtgccttacttccgccaagcaacacctgagcttgaacta
ggtaaactgcctctaggttcacgcccagcgaagcgtaacccgaatggtggtgtagaaagt
ttgcgtgcaattccatggatcttctcttggagccaaaaccgtttggttctaccagcatgg
ttaggcgcaggtgaggccattcagtactctgtagacaaaggtcatcaggcgctactggaa
gaaatgtgtcgtgaatggccattcttctcaactcgcctaggtatgcttgagatggtgtac
accaagtgcaacatggatatctctcgttactatgatcagcgcttggttgatgagccgctt
cagccgctgggtgatcgtctacgtgagcaacttcagcgtgatattaagtcagtactgaat
gtagagaacaacgagaacctgatgcaaagcgacccttggggcctagagtccattcgccta
cgtaacatctacgttgagccattgaacatgcttcaagcggaattgctgtaccgtactcgt
caaacagaagaagcttctgcaaacttagaagaagcattgatggtgacgattgctggtatc
gcagcaggtatgcgtaacacaggctaa

DBGET integrated database retrieval system