KEGG   Vibrio campbellii: VIBHAR_03063Help
Entry
VIBHAR_03063      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vha  Vibrio campbellii
Pathway
vha00250  Alanine, aspartate and glutamate metabolism
vha00410  beta-Alanine metabolism
vha00430  Taurine and hypotaurine metabolism
vha00650  Butanoate metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha02024  Quorum sensing
Module
vha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VIBHAR_03063
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VIBHAR_03063
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VIBHAR_03063
   00430 Taurine and hypotaurine metabolism
    VIBHAR_03063
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VIBHAR_03063
Enzymes [BR:vha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VIBHAR_03063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABU72013
UniProt: A7MZW2
LinkDB All DBs
Position
I:3086216..3087610
Genome map
AA seq 464 aa AA seqDB search
MPLHKKSALKGSILDDVYCSKDLSIVMPKYRIPENEHAASHAYQVVHDELMLDGNSRQNL
ATFCQTWAEDEVHKLMDECIDKNMIDKDEYPQTAEIESRCVHMLADLWHAPHAENPMGCS
TTGSSEAAMLGGMALKWAWREKMKKQGKPTDRPNLICGPVQVCWHKFARYWDIELREIPM
QGDRLIMTPEEVIKRCDENTIGVVPTLGVTFTCQYEPVKEVHDALDRLQEETGLDIPIHV
DGASGAFLAPFCDPDLVWDFRLPRVKSINASGHKFGLSPLGVGWVVWRDADALHEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGREGYRKIHEACYDTARYLAQEIEKMGM
FHIIYDGHGGIPALSWSIKEGANPGFNLYDLSDRIRSRGWQIAAYAMPAEREDLVIMRIL
VRHGFSRDLADLLITDLQHCVDFFDKHPVVNGSDADESSNFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccactccataaaaaatcggccttgaaaggctcaattctcgacgacgtctactgttct
aaagatctctctattgtgatgcccaagtatcgcattcctgaaaatgagcatgcggcctct
cacgcttatcaagtcgtccacgacgaactcatgctagatggaaactcccgccaaaaccta
gcgacgttctgccagacctgggcggaagacgaagttcacaagctgatggacgagtgcatc
gataaaaacatgatcgataaagatgagtatccacaaacagcagagattgagtctcgttgt
gtgcacatgttggctgacctttggcatgctcctcatgcagaaaacccaatgggctgctcg
acaacaggatcgagcgaagcagcaatgctaggcggaatggcgctcaaatgggcgtggcgc
gaaaaaatgaagaagcaaggcaaaccgactgaccgccctaatctcatctgtggtccggta
caagtgtgttggcataagtttgctcgttattgggatattgaattacgagaaataccaatg
caaggcgatcgcttaatcatgacaccggaggaagtgatcaagcgctgtgatgaaaatacg
atcggtgtggtgccaacacttggtgtgacttttacgtgccaatacgagcctgtaaaagag
gtgcatgatgcactggataggctccaagaagaaacaggcttagatattcccattcacgtg
gatggtgcaagcggcgcgtttctcgctccattctgcgaccctgatttagtctgggatttc
cgattacctcgcgtgaaatcgatcaacgcatctgggcataagtttgggctctcaccgctt
ggcgttggatgggttgtatggcgcgatgcggacgctttgcacgaagacctgatcttcaac
gtcaactaccttggtggcaacatgccaaccttcgccctcaacttctctcgtcctggtggg
caaatcgtagctcagtactataacttccttcgccttggccgagagggttaccgcaaaatc
catgaagcctgttatgacactgcccgctaccttgctcaagagatcgagaaaatgggtatg
ttccacattatctatgatggacacggtggtattccggcactgagttggtcaataaaagaa
ggggcaaatccagggtttaatctttacgatctttctgatcgtatccgatctcgtggttgg
caaatcgcagcgtatgcgatgccggcagaacgtgaagacttggtcatcatgcgaatttta
gtccgtcacggtttcagccgtgatttggctgacctactgatcacggatttgcagcactgc
gtggacttcttcgacaagcacccagtcgtaaacggcagcgatgcagacgagtctagtaac
ttcaatcacggctaa

DBGET integrated database retrieval system