KEGG   Vibrio campbellii: VIBHAR_03409Help
Entry
VIBHAR_03409      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
vha  Vibrio campbellii
Pathway
vha00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VIBHAR_03409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vha01002]
    VIBHAR_03409
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vha01011]
    VIBHAR_03409
Enzymes [BR:vha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VIBHAR_03409
   3.4.21  Serine endopeptidases
    3.4.21.-  
     VIBHAR_03409
Peptidases and inhibitors [BR:vha01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   VIBHAR_03409
Peptidoglycan biosynthesis and degradation proteins [BR:vha01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VIBHAR_03409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ABU72354
UniProt: A7MZH8
LinkDB All DBs
Position
I:3447122..3448492
Genome map
AA seq 456 aa AA seqDB search
MAYPHQEVLPEGSRVSLIAEKLNDQSELTGIHPTDQYFPPASTLKVVTALAAKLELGNGF
AFRTTLESSNSDAVLTFSGDPTLLTQDLKTMLRRAKKNGLNQIKGDLWLDNSAFTGYNRA
VGWPWDILGVCYSAPASAITLNDNCVQASIYTQKNGSTRVYVPEHQPINVKTSVQTVSRS
VQKSRHCDLDLIANPDNQYELTGCLVDRGDKPLPLKFAVQDTERYTSQKVQKLLKQVGIS
LKGNIRIGKAPEKQRKLLAVHKSKPLPQLLDQMLKRSDNLIADTLTKTLGAKFFVQPGSF
TNGTEAIKQIIFANTGVDIRNARLEDGSGLSRNNRISATSMAAILRYIWQHEKELNLIAI
MPKSGESGTLQYRKSMLKAPIKGQLIAKSGSLYGTYNMAGYGLDKNGKPNTLFVQFVSDY
FPEKRDDNKPVVPPITQFEKLFYQDIVSFSQAMPKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcctcatcaagaggttttgccagaaggctctcgtgtcagcttgattgctgaa
aaactcaatgaccaaagtgagctaacaggtattcatccaaccgatcagtatttcccacca
gccagcacgctaaaagtcgtcactgcattagcggcaaaacttgaactgggaaacggcttt
gcgtttcgcaccaccttagagagctcaaactcagacgcggtacttactttttctggagat
ccaacgttactgactcaagatctaaaaaccatgctgagacgagccaagaaaaatggtttg
aatcaaatcaaaggcgacctttggctagataacagcgcttttactggttataaccgtgct
gtaggttggccatgggatattctgggggtttgctacagtgccccagcttctgcgattacg
ttgaatgataactgtgtccaagcttctatctacacacagaaaaatggttctactcgcgtc
tacgtgccagaacatcaaccaataaacgtaaaaaccagtgttcaaaccgtctctagaagc
gttcagaagagccgtcactgtgatttagacctaatagctaacccagacaaccaatatgaa
ttaaccggctgtctggttgaccgcggcgacaaaccgcttcctcttaaatttgctgtgcaa
gatactgaacgctataccagccaaaaagtacaaaagttactcaagcaagttggtatctca
ttaaaaggcaatattcgaattggtaaagcaccagaaaagcagcgtaagttgcttgcagta
cataagtctaaaccgttgccacaacttttagaccaaatgctcaaacgctctgacaacttg
attgcagatacgctgactaaaacccttggtgcgaagttttttgttcaaccgggaagcttt
actaacggtacagaagccatcaaacaaatcatctttgcgaataccggtgtcgatattcgt
aatgcaagactggaagacggctctggcttatcacgcaataaccgaatttcagccacttct
atggcggccattttgcgttacatttggcagcatgagaaagagctgaacctgatcgcaatt
atgccgaagtctggtgagtcgggcactttgcaataccgtaaaagtatgctcaaagcgccg
atcaaaggtcagttgatagcgaagagcggttcgctgtacggaacctataacatggcaggc
tatggattagataagaacggaaaacccaatactttatttgttcagtttgtatcggactac
tttccagaaaagagggacgataacaagcctgtcgtcccccctattacgcagtttgagaag
ttgttctaccaagacattgtgagtttcagtcaggcaatgcctaagaagtag

DBGET integrated database retrieval system