KEGG   Vibrio campbellii: VIBHAR_03443Help
Entry
VIBHAR_03443      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
vha  Vibrio campbellii
Pathway
vha00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VIBHAR_03443
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vha01003]
    VIBHAR_03443
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vha01011]
    VIBHAR_03443
Enzymes [BR:vha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VIBHAR_03443
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VIBHAR_03443
Glycosyltransferases [BR:vha01003]
 Polysaccharide
  Bacterial polysaccharide
   VIBHAR_03443
Peptidoglycan biosynthesis and degradation proteins [BR:vha01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VIBHAR_03443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABU72388
UniProt: A7MYY2
LinkDB All DBs
Position
I:complement(3493331..3495721)
Genome map
AA seq 796 aa AA seqDB search
MTDTKKPGAKRAPAKKTTSSKTTTAKKSGAKRPRKSPSKKPSNGKRSWLKTIWSFSWKAG
VALAAVLLFVGIYLDSVVKDRFDGQLFDLPTVVYARILNLSPGENITIKEMRNELDVLNY
RKVSQPRYPGEYSSSSTRIELIRRPFEFADGPEPDRHVMLHFSSSGLQRIQSLESKGDLG
YLRIEPKMLGMLEKDQNEQRLFLRRDQFPEVLVDALLATEDRDFYQHDGVSPLAIGRALV
ANIKAGRTVQGGSTLTQQLAKNLFLTRDKTLWRKVREAYIALILDYRYSKDRILEAYLNE
VYLGQSGGDAIHGFALASRYYFGQPIQELRIDQLAMLVGMVKGPSYYNPIRYPERTKTRR
DLVLRLLMQQDMLTAEQYEQAVNRPLDTQSKPRIASRQPAYFQQLNIELKEKVGDNFKAE
TGLRLFTSLDPVSQSKLEQAIAKKVPELAKRAGKDLEAAAVAVDRHSGEIRAMVGGKRVG
YEGFNRALNASRPIGSLVKPAIYLTALEQPEKYNLATTLHDTPLSLKGSKGSVWSPRNFD
RKFRGDVPLYLALANSLNVPTVRLGMELGIPEVSDTLERLGVDKSEIRPVPSMFLGSFSL
TPFEVAQMYQTVTNSGKRAKLSALRSVIDMDGNVLYQSLPRSSQAVDQQAAWLTTYAMKQ
GVAQGTGRFLQSQFAWAALAGKTGTSNDSRDSWFVGVDGREVTTVWLGRDDNKSTKLTGS
SGALRVYAEYLKQRIPERLELPWPKEVTTLGFQKAATGALEMNCRSEYKLPVWDKSGQIK
QQCEKKSNWLNSLFDW
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgactgatactaaaaagcccggtgcaaaacgagcaccagcgaagaaaacaacgtcaagt
aaaacgacaaccgctaagaaaagcggcgcgaagcgaccgagaaaatcgccatcgaaaaag
ccgagtaatggcaagcgctcttggcttaaaactatttggtcatttagctggaaggcgggt
gtcgcgttagctgcggtattgttgtttgttgggatttatctcgatagtgtggttaaagat
cgttttgacggccagttgtttgatctaccaactgtcgtttatgcgcgtatcctcaattta
agtccgggtgagaacattaccatcaaagagatgcgtaatgagcttgatgtattgaactac
cgtaaggtgagtcagcctcgttaccctggtgaatactcttcttcttcaacgcgtattgag
cttattcgtcgtccgttcgagtttgctgatggccctgagcctgatcgtcacgtcatgctg
catttttcaagcagtggtctacagcgcattcaatctttggaatccaaaggcgatcttggt
tacctgcgcattgaacctaagatgctaggaatgttggaaaaagatcagaatgaacagcgc
ctgttcttacgtcgagatcaattcccagaagtgcttgtcgatgcgctgttagcaaccgaa
gaccgtgatttttatcagcatgatggtgtttcgccgctggcgattggccgtgcacttgtt
gctaacatcaaagcgggtcgcaccgttcagggcggcagtaccttgactcagcagctagcg
aaaaacttattcctgacacgcgataaaaccttatggcgaaaagtccgtgaagcatacatt
gctctgattctggactaccgctacagtaaagaccgtattcttgaagcttacctaaacgaa
gtttacttaggtcagagcggtggggatgccattcatggttttgctttggcatcgcgttac
tacttcggtcaaccgattcaagagcttcgtatcgaccaactcgctatgttagttggtatg
gtgaaaggaccgtcttactacaacccaattcgctaccctgagcgcactaaaacccgtcgt
gacttggtattgcgtctgttgatgcaacaagacatgttgactgcagagcagtacgaacaa
gcggtaaatcgcccgctcgatacacagagcaaacctcgtatcgcgagtcgtcagccggcg
tacttccaacaactgaacattgagctgaaagaaaaagtaggtgataacttcaaagctgaa
acaggcttacgtttgtttacttctctcgaccctgtatcgcaaagtaagttagagcaagct
atcgcgaagaaagtccctgagcttgctaaacgtgccggaaaagatctagaagccgctgcc
gttgcggtagatcgccatagtggtgaaatccgtgccatggtcggtggtaaacgcgttggt
tatgaaggctttaaccgtgccttgaatgcgagtcgtccgattggctctttggttaaacct
gccatctatttaaccgcgttagagcaacctgagaaatacaaccttgcaacgaccctgcac
gatacgccgttaagcctaaagggcagtaaaggttcggtttggtcaccacgcaacttcgac
cgtaagttccgtggcgatgtgccgttgtacttagccttagcgaactccctcaatgtacca
acggtacgtttgggtatggagctgggtattccagaagtttcggatactttagagcgattg
ggggttgataagagcgaaattcgcccagtaccttcgatgttccttggttcattctcactg
acaccatttgaagtggcacagatgtatcaaacggtcactaactcaggcaagcgcgctaag
ttatcggcattacgctcggtgatcgacatggatggtaatgtactttaccagtcattgccg
cgctcatctcaagcggttgatcagcaagctgcgtggctaacgacttacgcgatgaagcaa
ggtgttgctcaaggtacgggacgcttcctacaaagccagttcgcatgggctgcgctagcc
ggaaaaacgggtaccagtaacgatagtcgtgacagttggttcgtgggtgtcgatggccgt
gaagtaaccacagtgtggcttggtcgcgatgataacaagtctaccaaactgactggttca
agtggcgcattacgtgtttacgcggaatacctaaagcaacgcatccctgagcgactagag
ttgccttggccaaaagaagtgaccacattaggtttccaaaaagctgctactggcgcgctg
gaaatgaactgtcgcagtgaatacaagctgccagtgtgggacaagtctgggcaaatcaaa
cagcagtgtgagaaaaaatcaaactggttgaatagcttatttgattggtag

DBGET integrated database retrieval system