KEGG   Vibrio campbellii: VIBHAR_04761Help
Entry
VIBHAR_04761      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vha  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VIBHAR_04761
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VIBHAR_04761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 Thi4 DAO Thioredoxin_9 Chalcone_N NAD_binding_8 DUF5474
Motif
Other DBs
NCBI-ProteinID: ABU72670
UniProt: A7N772
LinkDB All DBs
Position
II:complement(27945..29513)
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEEVRLVVSLDESKASNDILSLANQIAEMSDLITVERDENASA
RKPVMAVTNPAKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKDLV
VEIFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGGLFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAEKLMGAAHTE
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNVDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGDT
SLEGVFAAGDATTIPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagaa
gttcgtttagtggttagtctagatgaaagcaaagcatcgaatgacattttgtctctagcg
aaccaaatcgcagagatgagcgacctaatcaccgttgaacgtgacgaaaacgcaagcgca
cgtaaaccagtgatggcggtaactaacccagcaaaaggcacggcactacgctttgcaggc
ttgccaatgggtcacgaatttacctctctagtattggctctgcttcattctggcggtcac
ccaatcaaactagaaccagaagtgattgagcaaatcgcagcactagacaaagatctagtc
gtagaaatcttcatttcactgtcgtgtcaaaactgtccggacgtggttcaagcgttcaac
atgatggcggcgatcaacccgaaagtaaaagcaaccatgatcgacggtggtttgttccaa
gatgaagtgaaacaacgcgacatcatggctgtaccaagtgtattcgtgaacggtgagcta
ttcggtcaaggtcgtatgtctctgactgaaatcctaaacaaagtggatgacggcgcgagc
gagaaagcggcgaaagcactgagcgaaaaagacccatacgacgtacttgttgtcggcggt
ggccctggtggtagcgcagctgctctatacgctgctcgtaaaggaattcgtactggcgtt
gttgctaaacgctttggtggtcaggttatggacaccatggcaattgagaacttcatttcg
gtaaaacgtactgaaggtccaaaactggcgactgacctagcagagcacctaaaagaatac
gatgtagacgtagtaactgagcaacaagctgagaagctaatgggcgcagcacacacagaa
gatggtttgattcacatccagcttgaaagcggcgcaacactgaagagtaagagtgtcatc
cttagccctggtgcacgctggcgtgaaatgaacgttccgggtgagcaagagtaccgtaac
aaaggtgtcgcgtactgcccacactgtgacggtccactgttcaaaggcaagaaaactgcg
gttatcggtggtggtaactcaggcatcgaagcagctatcgaccttgctggtatcgtagaa
cacgtaacggttcttgaattcgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgaactcactaccaaacgtagacatcatcacgatggcgcaaacaacagaagtagtaggc
gacggtactcgcgtaacaagcttgaagtacaaagaccgcaacacagatgaaatcaaagag
attgaactgtcaggtatctttgttcaaatcggtctagtaccaaacacagaatggttaaaa
gattcagaagtagccctatctgagcgcggcgaaattgaagtcggtagccgtggcgatact
agcctagaaggtgtgttcgcagctggtgacgcaacaaccattccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcatttgattacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system