KEGG   Vibrio campbellii: VIBHAR_05679Help
Entry
VIBHAR_05679      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vha  Vibrio campbellii
Pathway
vha00500  Starch and sucrose metabolism
vha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VIBHAR_05679
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VIBHAR_05679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ABU73577
UniProt: A7N404
LinkDB All DBs
Position
II:887551..889074
Genome map
AA seq 507 aa AA seqDB search
MKTFNLKPTLLPLTLLLSSPVMAAQNGTMMQYFHWYVLNDGALWTQVENNAPALSENGFT
ALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKDQYLDAIKAAHANNIQI
YGDVVFNHRGGADGKSWVDTERVDWNNRNIELGDKWIEAWVEFSFPGRNDKYSDFHWTWY
HFDGVDWDDAGKEKAIFKFKGDGKAWDWEVSSEKGNYDYLMYADLDMDHPEVKQELKDWG
DWYLNMTGVDGFRMDAVKHIKYQYLQEWIDYLRQKTSKELFTVGEYWNYDVNNLHNFITK
TSGSMSLFDAPLHMNFYNASRSGGNFDMRRIMDGTLMKDNPVKAVTLVENHDTQPLQALE
SPVDWWFKSLAYAFILLREEGYPSVFYADYYGAQYSDKGHDINMVKVPYIEKLVKARKDY
AYGKQHSYLDHWDVIGWTREGDAEHPNSMAVIMSDGPGGTKWMYTGSPSTRYVDKLGIRT
EEVWTDANGWAEFPVNGGSVSVWVGVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcaaccttaaacccacacttttacctttaactttgctgctcagttcgcca
gtaatggcggctcaaaatggaaccatgatgcagtatttccattggtatgtgctaaatgac
ggtgcactctggacacaagttgaaaacaacgcgccagcactatcggaaaacggctttacc
gcgttatggctaccgcctgcctataaaggtgctggtggcagcaacgacgtcggttatggc
gtttacgatatgtatgacttgggggagtttgatcaaaaaggatcggtgcgaaccaagtac
ggtacaaaagaccaatacctcgatgccatcaaagcggcacacgcaaacaacattcaaatt
tatggtgatgtggtgtttaaccaccgtggcggtgcggatggtaaatcgtgggtcgacacc
gagcgagtcgattggaacaatcggaacattgaactcggcgacaaatggattgaagcttgg
gtcgaatttagctttccggggcgtaacgacaaatactcagatttccattggacgtggtat
cactttgacggcgttgactgggatgacgcaggtaaagaaaaagcgatcttcaaattcaaa
ggcgatggcaaagcatgggattgggaagtcagttctgaaaaaggcaactatgactacctc
atgtacgcagatttagacatggaccacccagaagtgaagcaagaactgaaagactggggc
gattggtacttaaatatgacgggtgtggatggcttccgaatggacgcagtcaaacacatc
aaatatcaatacctgcaagagtggatcgattacttgcgacagaaaacgagcaaagagttg
tttactgtcggtgagtactggaactacgacgttaacaatctgcacaactttatcaccaag
acgtctggcagtatgtcgttgtttgatgcaccgttacacatgaacttctacaacgcttca
cgctcaggtggtaacttcgacatgcgtcgtatcatggatggtaccttgatgaaggacaac
ccagtgaaagcagtgactctggttgagaaccacgatacgcagcctcttcaagcgctagaa
tctccagtcgattggtggtttaagtctctcgcgtacgcgtttatcttgctacgtgaagag
ggctatccgtcagtcttttatgctgattactacggcgcgcaatacagtgataaagggcac
gacatcaacatggtgaaagtgccgtatattgagaaattggtgaaagcccgtaaagattat
gcttatggcaagcagcactcttaccttgatcattgggatgtgattggttggacgcgagaa
ggggatgcagaacacccgaactcaatggcggttatcatgagtgatggccctggcggtaca
aaatggatgtacacaggttcaccaagtacgcgttacgtcgataagttaggtattcgcacg
gaagaagtttggactgacgccaacggttgggcagagttcccagtgaacggtggttcggtt
tctgtttgggtcggcgttaaataa

DBGET integrated database retrieval system