KEGG   Virgibacillus halodenitrificans: BME96_02335Help
Entry
BME96_02335       CDS       T04548                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00473  D-Alanine metabolism
vhl01100  Metabolic pathways
vhl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BME96_02335
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BME96_02335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vhl01011]
    BME96_02335
Enzymes [BR:vhl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BME96_02335
Peptidoglycan biosynthesis and degradation proteins [BR:vhl01011]
 Precursor biosynthesis
  Racemase
   BME96_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APC47102
UniProt: A0A1J0GXV5
LinkDB All DBs
Position
444157..445281
Genome map
AA seq 374 aa AA seqDB search
MSDTIYRNTWVEVDLEAIEYNLQQIKKRISNKTKIIAVVKADGYGHGSVQVAKKAIKAGA
SALAVALFEEALTLREAEITVPILVLGWVPAKAAPIAAVNNITLTFFQKEWLQEVSTYQL
EDKLHVHMKWDTGMGRIGVRTKSELKELLYALNENPSIYLTGVFTHFATADEADMSYFYE
QKSRFEEMLKTFTEVWGKPVDVHIGNSASAIRLPEEMYDYIRFGIAMYGLYPSGTVKSER
DVELKQAFSLHSRLAHVKKIAAGETVSYGATYKAEKDEWIGTIPIGYGDGWIRKLQGVDV
LVNGKRMPIVGRICMDQTMIRLDGEYPIDTKVTLIGKQNSAEIEMDEIAAHAETINYEIP
CIINQRVPRLYKNE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaccatatacagaaatacctgggtagaggtagatctggaagcgattgaatac
aatcttcaacaaattaaaaagcgtatttccaataagacgaagatcattgcagtagtgaag
gccgatggttacggacatgggagtgtgcaggttgcgaagaaggcaattaaagcaggtgct
agtgcgttggctgttgctctatttgaagaggcattaacacttagggaggcagaaattacg
gtccctattttagtgctgggctgggtccctgcaaaagcagcaccgatagctgcagttaac
aatattactttaactttttttcaaaaagaatggctacaggaagtaagtacttatcaatta
gaggataagctacatgtccatatgaaatgggatacaggtatggggaggattggtgtaagg
acaaaatctgaactgaaagaactcctttatgcattaaatgaaaatcccagcatatattta
acaggagtgttcacacattttgcaactgctgatgaagctgatatgtcctatttctatgaa
cagaaaagtcgttttgaagagatgctgaaaacatttacggaggtatgggggaagccggtt
gatgttcacattggtaatagtgctagtgcgattcgtttacctgaagaaatgtatgattat
atccgtttcggaatcgctatgtatggattatatccatctggtacggtaaagtctgaaaga
gacgtcgaattaaagcaagcattttccttgcacagcagactggctcacgtcaagaagata
gctgctggagaaacagttagctatggcgcaacctataaagcggaaaaagacgaatggatt
ggaacgattccaattggctatggagacggatggataaggaagctacaaggggtagatgta
ctggttaatggaaaaagaatgcctattgtagggagaatatgtatggatcaaaccatgatt
cgacttgatggggaatatcctattgatacgaaggttacactgataggtaagcaaaatagc
gcagaaattgagatggacgaaatcgccgcccatgcagaaactattaactatgagattcct
tgtataatcaatcaacgggttccacgcttgtataaaaatgaatag

DBGET integrated database retrieval system