KEGG   Virgibacillus halodenitrificans: BME96_03050Help
Entry
BME96_03050       CDS       T04548                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:vhl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BME96_03050
Enzymes [BR:vhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BME96_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 DUF373
Motif
Other DBs
NCBI-ProteinID: APC47220
UniProt: A0A1J0GY95
LinkDB All DBs
Position
595613..597109
Genome map
AA seq 498 aa AA seqDB search
METVSLQTEKLANYINGEWVEVNESTSVINPATGEEVVQVPLSEADSVEQAVAAAKKAQK
EWALVPAPQRAEVLYQVGYIMKERKERLSQLLTMENGKVIEEARGEVQEGIDMAFYMAGE
GRRLFGQTTPAELKDKFAMSQRCPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPA
TETPIMAYELAKIFEEAGLPKGIINVVFGKGSTVGDAMVHHDDIRVISFTGSNDTGRNIA
GECGKQLKKVSLEMGGKNAVIVMDDADIDLAVEGILWSAFGTSGQRCTACSRVIVHEKVK
ETLEERLLASMEKLTIGNGLDESNKVGPIINKAGLDKIKSYIEIGKNEGAKLLAGGYEIT
DGEQRAGNYFAPTLFTDATADMRIAQEEIFGPVVSLIPVKSFEEAIEVNNGVTYGLSSSI
FTGDVNRVFKAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVQALDVFTEWK
AVYVDYSGKLQRAQIDVE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggagacagtatcactacaaacagaaaaactagcaaattacattaatggtgaatgggtg
gaagtaaatgaatctacttctgttatcaatccggcaacaggagaagaagttgttcaggtt
cctctttccgaagctgatagtgtggaacaagcagtagctgcagcgaaaaaagcgcagaag
gaatgggcattggttccggcaccacagcgagcagaggtactttaccaggttggatatatt
atgaaggagcgtaaagaaagactttcccagcttttaacgatggaaaatggaaaagtaatc
gaagaagcacgtggcgaagttcaagagggaatcgatatggctttttacatggcaggagaa
ggacgccgcttattcggtcaaacaacaccagcagagttaaaagataaatttgcgatgagc
cagcgttgtccagtaggtgttgtaggtattatcaccccatggaattttccaattgcgatt
gctacatggaagtcattcccggcaattgttgcggggaatgcagtagtttggaagcctgca
acggagactccgattatggcatatgaattggctaagatttttgaagaggctgggctacct
aaaggtattattaacgttgtctttggcaaagggtcgaccgtaggagatgcaatggtgcat
catgacgacatacgtgttatatccttcacagggtcaaatgatacaggtcgtaatatagca
ggtgaatgtgggaagcagttaaagaaggtatctcttgaaatgggtggaaaaaacgcggta
attgtaatggacgacgctgatatcgatttggctgtagaaggaattctatggagcgcattt
ggcacaagtggccaacgttgtacagcatgcagccgagttatcgtacatgaaaaagtaaaa
gaaacgttggaagaacgattgcttgcttccatggaaaaattaactattgggaatggctta
gatgaatccaataaggttggcccgattattaataaagctggcttggataagataaaaagc
tatattgaaatcggtaagaatgaaggggccaaattgttggcaggtggctatgaaataacc
gacggtgagcaacgtgcagggaattattttgctcctacgttatttacggatgctaccgca
gatatgagaatagcacaagaggagatctttggtcctgtcgtatctcttattccggttaaa
agctttgaagaagcaatagaagtgaataatggggttacgtacggtctatccagttctatt
ttcacaggggatgtaaatagagtgtttaaagcacaacgtgatttagatacgggaattgtt
tacgttaatgcgggaacaactggagcggaaattcaccttccatttggtggcacaaaaggt
actggaaatggacatcgtgattctggagtacaggcgctggatgtgttcacggaatggaaa
gcagtctatgtcgattacagtggaaagctgcaacgtgctcaaattgacgtggaataa

DBGET integrated database retrieval system