KEGG   Virgibacillus halodenitrificans: BME96_05980Help
Entry
BME96_05980       CDS       T04548                                 

Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00561  Glycerolipid metabolism
vhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BME96_05980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vhl04147]
    BME96_05980
Enzymes [BR:vhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BME96_05980
Exosome [BR:vhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BME96_05980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: APC47744
UniProt: A0A1J0GZS0
LinkDB All DBs
Position
1143012..1144508
Genome map
AA seq 498 aa AA seqDB search
MDNKFILALDQGTTSSRAIIFNQKGEIVETAQKEFEQFFQHPGWVEHDANEIWNSVLACI
AEALRKADIGPEQIAGIGITNQRETTVVWDKDTGKPVYKAIVWQSRQTEEICRELREKGL
NDLVRDKTGLLIDPYFSGTKVKWILDHVEGAREKADKGKLLFGTMDTWLVHKLSGGKVHI
TDYSNASRTLMFNIHELKWDEELLDMLTVPKSMLPEVRQSSEVYAKTVDYHFFGHEIPIA
GIAGDQQSALFGQACFEKGMAKNTYGTGGFMLMNTGDKAVKSENGLLTTLAWGVDGKVEY
ALEGSIFVSGSAIQWLRDGLRIIDSAPDSEYYATRVDSTDGVYMVPAFVGLGTPYWDSDA
RGSFFGITRGTKREHIVRATLESLAYQSKDVLDAMIADSDIDLKTLRVDGGAVKNNFLMQ
FQSDILNVPVEVPVIQETTALGAAYLAGLAVGYWKDKEEIAKQWQNDKTFTSELKEEKSN
ELYEGWKKAVEATRAFKI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggataacaaatttattttagcattggatcaagggacgacaagttcacgtgccatcatc
tttaatcaaaaaggggagattgttgaaacagcacagaaggaattcgaacagttttttcag
catcctggttgggtagaacatgatgcgaatgaaatttggaactctgtgctggcttgtatt
gcagaagccttaagaaaagcagatattggaccggagcaaattgccggcattgggattacc
aatcaacgggagacaactgtagtatgggataaagacacagggaaaccagtatacaaagcc
attgtctggcaatcacgacagacagaagaaatatgcagggagcttagagagaaagggcta
aatgatttagttagagataaaacaggactacttattgatccatacttttctggaacaaag
gtgaaatggattcttgatcatgtagaaggggcaagagaaaaagcagataaaggaaagtta
ttatttggaacaatggatacgtggcttgtacacaagctatccggcggaaaggtgcatatt
acagattactccaatgcttccagaacattaatgtttaatatacatgaattaaaatgggat
gaagaattattagatatgttaactgttcctaaaagtatgcttcctgaagttcgtcaatca
tcggaagtatatgcgaaaactgtagattatcacttctttggacatgaaattccaatcgct
ggaattgccggagatcagcaatcagccctgtttggtcaggcttgttttgaaaagggaatg
gccaagaacacctatggcactggtggttttatgttaatgaacacaggtgataaggcagtg
aagtcagagaatgggttattaacaacgcttgcttggggtgttgacggaaaagtggaatat
gcactggaaggaagtatctttgtttcaggctctgctattcaatggctgcgtgatggttta
agaatcattgatagcgcaccagatagtgaatattatgctacccgggttgattcaacagat
ggagtctatatggtgccagcatttgtcggcttaggtacaccatactgggatagtgatgca
cgtgggtccttcttcggtataactagaggtacaaagcgcgaacatattgttcgtgcaaca
cttgaatcgctcgcttatcaatcaaaagatgtgcttgatgcaatgatcgcagattcagat
attgatttaaaaacactgcgtgtggatggcggtgcggtgaagaataattttctaatgcaa
ttccagagtgatattttaaacgtacctgtagaagttcctgtcattcaggaaacaacagca
ctaggcgcagcgtatcttgctggtttggcagtcggttattggaaggacaaggaagagatt
gcgaaacaatggcaaaacgataaaacgtttacaagtgagctgaaagaggaaaaaagtaat
gagttatatgaaggttggaaaaaggcagtagaagcaacaagagcatttaagatatag

DBGET integrated database retrieval system