KEGG   Virgibacillus halodenitrificans: BME96_08160Help
Entry
BME96_08160       CDS       T04548                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BME96_08160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vhl03400]
    BME96_08160
Enzymes [BR:vhl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BME96_08160
DNA repair and recombination proteins [BR:vhl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BME96_08160
    RecFOR pathway proteins
     BME96_08160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH WIYLD 5_3_exonuc IMS_HHH DUF3701 HHH_8
Motif
Other DBs
NCBI-ProteinID: APC48149
UniProt: A0A1J0H0Z6
LinkDB All DBs
Position
1579029..1579643
Genome map
AA seq 204 aa AA seqDB search
MIAYIKGNLTYIQDESVIVEVQGIGYEIICANPFVFQHLLNKEVLISTYHYVREDIQVLY
GFKDEDQKYLFTKLISVSGIGPKGALAVLGTVNVADFVGAIEREDDKYLTSFPGVGKKTA
RQIILDLKGKLTTMISISSTDSDHELQHKEVNQNLAQLDEAKEALKALGYTDREIKSVLP
KLPNDENNSTDTIIRKALALLMKN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcatacataaaaggtaatcttacatacattcaagatgaatcagtgatagtagaa
gttcaaggaattggctatgaaataatttgtgccaatccctttgtttttcaacacttgctt
aacaaagaagttttaataagtacctatcactatgtacgggaagatatccaagttttatat
ggctttaaagatgaagatcaaaagtatttatttaccaagttaatttccgtctcgggaata
ggaccaaagggtgcattggcagttcttggtacagttaatgttgctgattttgtaggtgca
attgaacgggaagatgacaaatatttaacaagttttccaggtgtaggaaaaaagactgcg
agacagataattttagatttaaaaggcaaattaactactatgatttctatttccagtaca
gattctgatcatgaattacaacacaaagaagtaaatcaaaaccttgcacaattggatgaa
gcaaaagaggctttaaaagcattaggatacacggatcgtgaaattaaatcagttctgcct
aaactacctaatgacgaaaataattctactgacacaataatacgtaaagcactagcatta
ctaatgaaaaattaa

DBGET integrated database retrieval system