KEGG   Virgibacillus halodenitrificans: BME96_08715Help
Entry
BME96_08715       CDS       T04548                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vhl  Virgibacillus halodenitrificans
Brite
Enzymes [BR:vhl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BME96_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: APC48245
UniProt: A0A1J0H192
LinkDB All DBs
Structure
PDB: 

Position
1688248..1688859
Genome map
AA seq 203 aa AA seqDB search
MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHEDLKNKSLNDLIS
NLDAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEF
AAAAAGRFGSGWAWLVVNNGEIEIMSTPNQDNPLMEGKKPILGLDVWEHAYYLKYQNKRP
DYISAFWNVVNWDEVEKNYNEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattaccagaactaccatatgcgtatgatgcgctagaacctactatt
gataaagaaacaatgaatattcaccatacgaagcatcacaacacttatgtgactaagtta
aatggtgctttggaaggtcacgaggatcttaaaaacaaatctcttaatgaccttatcagc
aatttagatgcagttcctgaaaatattcgcacagcagttcgtaataatggtggcggtcat
gcaaaccacagtcttttctggaagttaatgtctccaaatggcggtgggaaaccaacaggg
gaagttgcagataaaattaatgataaatatggcagctttgaaaaattccaagaagaattt
gctgcagcagcagctggccgttttggctcaggttgggcatggttagtagtaaataacgga
gaaattgaaattatgagtactccaaatcaagataacccattaatggaaggaaagaaacca
attttgggacttgatgtttgggagcatgcttactatttaaaatatcaaaataagcgtcct
gattatatttcagctttctggaatgtagttaattgggatgaagtagaaaagaattacaac
gaagctaaataa

DBGET integrated database retrieval system