KEGG   Virgibacillus halodenitrificans: BME96_13465Help
Entry
BME96_13465       CDS       T04548                                 

Definition
(GenBank) flagellar biosynthesis anti-sigma factor FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl02020  Two-component system
vhl02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BME96_13465
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BME96_13465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:vhl02035]
    BME96_13465
Bacterial motility proteins [BR:vhl02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    BME96_13465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM MtrA
Motif
Other DBs
NCBI-ProteinID: APC49143
UniProt: A0A1J0H3S0
LinkDB All DBs
Position
complement(2616962..2617222)
Genome map
AA seq 86 aa AA seqDB search
MRINGPNNTNMNPYKNHFQKQVDTKTEAKKDQLEISSKAKEMLEKDKPNAERAAYVQEIK
QAVENGEYKVDHEKTARKMIDFWSGF
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataaatgggccgaacaatacgaatatgaacccatataaaaatcacttccaaaag
caggtggatacaaaaacagaagccaaaaaagatcagttggaaatctctagtaaggcaaag
gaaatgcttgagaaagataagcccaatgcagaacgggcagcatatgtacaagaaataaaa
caagcggtagaaaatggagaatataaagtggatcatgagaaaacagcccggaaaatgatt
gatttctggagcggattttaa

DBGET integrated database retrieval system