KEGG   Virgibacillus halodenitrificans: BME96_13470Help
Entry
BME96_13470       CDS       T04548                                 

Definition
(GenBank) hypothetical protein
Organism
vhl  Virgibacillus halodenitrificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C4pol zinc-ribbons_6 zf-UBR
Motif
Other DBs
NCBI-ProteinID: APC49144
UniProt: A0A1J0H3R1
LinkDB All DBs
Position
complement(2617259..2617675)
Genome map
AA seq 138 aa AA seqDB search
MAELANCSRCEAVFVKSIRDICQACYKEEEQAFDTVYKFLRERKNREATMLEIVDATKVD
ETLITKFIKEKRLRTTDFPKLAYPCESCGANIVNGKLCFDCSDELRRDLDKHNQQQRKIQ
EKELKKNTHTYYMFDKNK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttagcgaattgctcacgctgtgaagcggtttttgtcaagagcatccgtgat
atatgccaagcttgctataaggaagaggagcaagcttttgatacggtttataagtttctg
cgtgaacgaaaaaacagggaagcaactatgttagaaattgttgatgcaacaaaggtagat
gaaaccttgattacaaaatttattaaagaaaaaagattgcgaacaactgactttcctaaa
ttggcttatccttgtgagtcatgcggagctaatatagtaaatgggaaattatgctttgat
tgctcggatgaattgaggagagatctcgataaacataatcaacaacaacgaaaaattcaa
gaaaaagaattgaagaaaaatacacatacctattatatgtttgataagaacaagtga

DBGET integrated database retrieval system