KEGG   Virgibacillus halodenitrificans: BME96_13700Help
Entry
BME96_13700       CDS       T04548                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00627  Aminobenzoate degradation
vhl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BME96_13700
Enzymes [BR:vhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BME96_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh GCV_H DUF349
Motif
Other DBs
NCBI-ProteinID: APC49186
UniProt: A0A1J0H3V9
LinkDB All DBs
Position
2667015..2668475
Genome map
AA seq 486 aa AA seqDB search
MNQFNLLKGNYIAGKWRDGSSNQQMVNKNPYNDAIIANYQAASLQDLDEAYQSANHVQKE
WKNTNPVIQREVFEKAVSYIEEKHESIVEIIINEIGGTRLKAEFEIGLVKNIMKEASTLP
FRMDGKILPSPIDHKENRVYRVPVGVVGVISPFNFPFFLSMKSVAPALATGNGVVLKPHE
HTSITGGTMIAKIFEEAGLPEGLLNVITTEISEIGDHFVAHPIPRAISFTGSTKVGKHIG
AVAGKHLKEAHLELGGNSALVVLEDADIDLAVSAAVFSRFTHQGQICMSANRLIVHEAIY
QEFVDKYTAKVATLTCGDPSDPSTIIGPLINEQQVKGTVALIEKGIEEGAVPVIRGEVKG
NVVEPVVFTNVTPDMSLAKEELFAPVVSIMKVKNDQEVLSYANNSLYGLSGAIHTRNVER
GAELAKQMDTGMIHINDGTINDEPNVAFGGVKNSGLGRLNGDWSLDAFTTTKWISIQHKA
RQYPYS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttaatctattaaaaggaaattacattgctggtaaatggcgtgatgggtca
agcaaccagcagatggtaaataaaaatccatataacgatgctattatagcaaactatcaa
gctgctagccttcaggatttggatgaagcataccaatcagcaaatcatgtacaaaaagaa
tggaaaaacacaaatcctgtaatacaaagggaagtatttgaaaaagcagtttcttatata
gaagaaaaacatgaatcaatcgtagaaattataataaatgaaattggcggaacaagattg
aaagccgaatttgaaattggtctggtaaaaaatattatgaaggaggcatctacactacct
tttcgaatggatggaaaaattcttccgtctccaattgatcataaagaaaaccgagtttat
cgtgtccctgttggagtagtcggagtaataagtccgtttaactttccgtttttcctttct
atgaaatcagttgcgccagctctagcaacaggaaacggagtggttcttaaaccacacgaa
catacttctattaccggcggaacgatgattgcgaagatttttgaggaagccggattacct
gaaggtctgcttaacgttatcacaactgagatatcggaaatcggtgatcactttgtagca
cacccgatacctcgtgccatatcttttacaggttcaacgaaggttggaaaacacatcgga
gcagttgcaggtaaacatttaaaggaagcacacttggaattgggaggcaatagtgcactt
gttgtgcttgaagacgcagatattgacctagccgtaagcgctgcagttttcagtcgcttt
actcaccagggacaaatttgtatgtctgcaaatcgtttaattgttcatgaagcaatttat
caagaatttgtagataaatacacagccaaagtggcaacattaacatgcggcgatccaagc
gatccaagcaccatcatagggcctttaataaatgaacagcaagtaaaaggaaccgtggcg
ctcatagaaaaaggaatagaggaaggagctgtccctgtaattagaggagaagttaagggg
aatgttgtggaaccagttgtatttacgaatgtcacacctgatatgtcgttagcgaaggaa
gaattattcgcgccagttgtaagtattatgaaagtaaaaaatgaccaagaggtactttcg
tatgcaaataatagtctttacggtcttagtggagccattcatactagaaatgtagaacga
ggagcagagttggccaagcaaatggacacagggatgattcatataaacgatgggacaata
aatgatgaaccaaatgttgcattcggtggggtgaaaaattccggcttaggtcgtctgaat
ggagactggagtctagatgccttcactactacaaaatggattagtattcagcataaagca
agacaatatccttactcctag

DBGET integrated database retrieval system