KEGG   Vibrio harveyi: AL538_00185Help
Entry
AL538_00185       CDS       T04380                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
vhr  Vibrio harveyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NAD_binding_3 ADH_zinc_N_2 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AMF96251
UniProt: A0A454B2F2
LinkDB All DBs
Position
1:40152..41204
Genome map
AA seq 350 aa AA seqDB search
MKAIVKTQNNPGKLELLDVPVPEIGPDDVLIKVEAAGICGSDLLFSTTVELPVPSTLGHE
FAGVVQEVGENVKAWKPGDRVVSDNTGYACGECYACATSQYLECEHRIALGYGFDGGFAE
FVKVPGQILRLNPKTLFKIPDNVSFEAASMLDPCANAYQALLQKSSFKSGDDVVIYGVGT
IGLLCVQIAKVAGANNIIVMGMERNGIPESNLTLALELGATHAFVSTHENIVEKIENTLG
KKPRIIIDCAGSPQVLKQALSCISNGGEIVKIGFDHTDLNIDFNIVVLKGVKIIGNMGYN
YISWANSLSLMEKGAINTLKIISHRLKLSEYQTGFELMFNKKAKKVILNP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctattgtaaaaacacaaaacaatccagggaagcttgagttgctcgatgttccg
gtaccagagatcggccccgatgatgttctaattaaggttgaagcagctggtatttgcggt
tcagacttattattttctacaactgtagaattgcctgttccttcgacgttagggcatgaa
ttcgcaggggtagtacaagaagtcggtgaaaatgtaaaagcatggaaaccgggagaccgg
gttgtttctgataatactggttatgcttgtggcgaatgttatgcgtgtgcaacaagccaa
tatctagaatgtgagcaccgtatcgcattagggtatggctttgatggtggttttgctgaa
ttcgttaaagttccaggacaaatcctaagactcaatcccaagacattattcaaaatcccg
gataatgtttcattcgaagcggcgtccatgttagatccttgtgctaatgcctatcaagca
ctattgcaaaaatctagcttcaaatcaggtgatgatgtcgttatttatggcgttgggact
attggcttgctttgtgtacaaatagcaaaagtagcaggtgctaataatataattgtaatg
gggatggagcgtaatggtattccggagtcgaatctcactttagctttagagttgggtgcg
acacacgcgtttgtttctactcatgaaaatatagttgagaaaatcgagaatacattagga
aagaaacctcggattattattgattgcgcgggctctccccaagttctaaaacaagcattg
tcttgtattagtaacggtggtgaaatcgtaaaaattggttttgatcacactgatttaaat
atcgattttaatattgtcgttcttaaaggagtaaaaataattggaaatatgggatataac
tacatatcttgggctaatagtttgtctctaatggaaaaaggagctattaatacattgaaa
ataatttctcatagattaaagctttctgaatatcaaactggatttgaattaatgtttaat
aagaaagccaaaaaagttattttaaatccttaa

DBGET integrated database retrieval system