KEGG   Vibrio harveyi: AL538_03325Help
Entry
AL538_03325       CDS       T04380                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
vhr  Vibrio harveyi
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vhr03400]
    AL538_03325
Enzymes [BR:vhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AL538_03325
DNA repair and recombination proteins [BR:vhr03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AL538_03325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 RNase_H_2 DNA_pol_B_exo2
Motif
Other DBs
NCBI-ProteinID: AMF96827
UniProt: A0A454B3M6
LinkDB All DBs
Position
1:685525..687888
Genome map
AA seq 787 aa AA seqDB search
MNIQQGFLLTRQARDIKGQTQIELWLSTENGPTQLLIQGERPVFFIEQAQIEQTKRFATS
KQIAVDIRSLELKNFQLTPLAACYTQTTKDAFALQDELKQNDIVHFEGDVRLADRYLMER
FIKGSMEFTGNQQSLNGFQRIQNAKCRTGEYQPKLHVVSLDLECSEKGILYSIGLDSPVD
SRVIMIGEPEQAETPIQWVKDEKALLDALIAWFKKFDPDVIVGWNVIDFDFRLLHKRAEW
HNMKLILGRADQPSFFRSSAQSQQGFISIPGRVVLDGIDTLKTATYHFRSWSLESVSQEL
LGEGKEIHNVHDRMDEINRMYRSDKPSLAKYNLQDCVLVNKIFDHTHLLDFAIERSRLTG
VELDRVGGSVAAFTNLYLPQIHRAGYVAPNLHPENWIASPGGYVMDSIPNLYDSVLVLDF
KSLYPSIIRSFLIDPMGLVEGLQLEIGKAEDEAVPGFRGGQFHRSKHFLPEMIEKLWAAR
DVAKKNNEKAFSQAIKIIMNSFYGVLGSSGCRFFDTRLASSITMRGHEIMKQTKVLIEAK
GYQVIYGDTDSTFVSLNGPYSQADADKIGIELVEYINQWWGDHLRDEYNLNSILELEYET
HYRKFLMPTIRGAETGSKKRYAGLIGEGEKERIIFKGLESARTDWTPLAQRFQNTLYQMI
FHGEDPSDYVREMVEKTNSGEFDDQLVYQKRLRRKLHEYQKNIPPQVRAARLADDINAKL
GRPLQYQNRGRIEYLITVNGPEPHEYRNSPIDYQHYIDKQLKPIADAILPFIGTDFERLS
APQMGLF
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatccaacaaggcttccttctcactcgacaagcccgagacatcaaaggtcaaact
caaattgagctttggctttcgaccgagaatggtccgacccaattgttgattcaaggagaa
agaccggtcttctttatcgagcaagcacaaatcgagcaaaccaagcgatttgccacttct
aagcaaattgctgtcgacatacgctcgcttgagttaaagaacttccaactaactccttta
gccgcgtgttatacccagaccacgaaagacgcattcgctctacaagatgaactgaagcaa
aacgacatcgtccatttcgagggcgatgtacgacttgccgatcgttatctgatggaacgc
tttatcaaaggcagtatggagtttaccggtaaccaacaatcactaaacggcttccaacgc
attcaaaatgcaaagtgtcgcacaggtgaataccaacctaagttgcatgtggtctctcta
gatttggaatgctcagagaaaggcattctctactcgattggtttagatagccctgttgat
tcacgtgtgattatgattggcgaaccggaacaagcagagacgccaattcaatgggtaaaa
gatgagaaggctttgctcgatgctttaattgcgtggtttaagaaatttgacccagatgtg
attgttggttggaacgttatcgacttcgatttccgtctgctgcataagcgcgcagagtgg
cataacatgaagctgatattaggtcgtgcagaccagccaagtttcttccgcagctcagca
caaagccaacagggctttatctctattcctggtcgtgttgtgctggatggtatcgatacg
ctcaaaaccgcgacctaccatttccgttcttggtcacttgagtctgtttcacaagaactc
cttggcgaaggtaaagaaattcataacgtgcatgacagaatggatgaaatcaatcgcatg
taccgttcagacaagccgtctctcgctaaatacaacttgcaagactgtgtgttggttaac
aagatttttgaccacactcacctactcgacttcgcgatagaacgctcccgcctaacaggt
gtggaattagaccgcgttggggggtcagtagccgcatttaccaatttgtatctgcctcaa
atccaccgagcaggctatgttgccccaaacctgcatccagaaaactggatcgccagccca
gggggctatgtgatggactctatcccgaacctttacgattccgtattggtgctcgatttt
aagagtctttacccctctattattcgctcattcttgattgaccctatgggtttggtcgag
ggcttacagcttgaaatcggcaaagcagaagatgaagcggtaccgggatttcgtggtggt
cagttccatcgctcgaaacactttctacccgagatgatcgaaaagctctgggcagcccgc
gacgtcgcaaagaagaacaatgagaaagccttctcgcaagctatcaaaatcatcatgaac
tctttctatggcgtgcttggttcttccggttgtcgtttctttgatacccgccttgcttca
agcatcaccatgcgtgggcacgaaattatgaagcaaaccaaggtgctgatcgaagccaaa
ggctatcaagtgatttatggcgataccgattcaacttttgtgtcgttaaatggcccgtat
agccaagcagatgccgataagattggtattgaactggtcgaatacattaatcaatggtgg
ggtgatcaccttcgcgatgaatacaatctcaattcgattcttgagctagaatacgaaacc
cattatcgcaagttcttgatgccgaccattcgaggcgcagaaactggctcaaagaaacgc
tacgctggtctaattggtgaaggtgaaaaagaacgtatcatctttaaagggttagagagc
gcacgcaccgactggacaccgctggcgcagcgtttccaaaacaccttgtaccaaatgatt
ttccatggtgaagatccgagtgattacgtacgagagatggttgaaaaaaccaatagtggc
gagtttgatgatcaattggtttatcaaaagcgcttacgtcgcaagctgcacgaataccaa
aagaacattccgccacaagtacgcgctgcgcgcttagccgatgacatcaatgctaaatta
ggcagaccattgcagtatcaaaaccgtggtcgaattgaatatttgatcactgtgaacgga
ccagaaccgcatgagtaccgtaatagccctatcgactatcagcattatattgataaacag
ctaaaaccgatcgcggacgctattttgccgttcattggcacagacttcgagcggttatct
gcaccacagatggggctgttctaa

DBGET integrated database retrieval system