KEGG   Vibrio harveyi: AL538_07760Help
Entry
AL538_07760       CDS       T04380                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
vhr  Vibrio harveyi
Pathway
vhr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr01130  Biosynthesis of antibiotics
vhr01230  Biosynthesis of amino acids
Module
vhr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AL538_07760
Enzymes [BR:vhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AL538_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK TsaE ABC_tran AAA AAA_16 APS_kinase AAA_22 AAA_25 AAA_17 Ploopntkinase3 AAA_28 CoaE AAA_5 AAA_7 AAA_24 AAA_PrkA RNA_helicase His_biosynth AAA_29 IstB_IS21 Guanylate_kin RsgA_GTPase Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AMF97627
UniProt: K5VT83
LinkDB All DBs
Position
1:complement(1642614..1643132)
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFVDSDTVIEERTGADIAWVFDVEGEEGFR
KREEAVLEDLTQEQGIVLATGGGSVKSKENRNRLSARGVVVYLETTIEKQLARTNRDKKR
PLLQTENPREVLESLAGERNPLYEEVADYTVRTDDQSAKVVANQIVKMLEER
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgtaatattttccttgttggcccaatgggtgccggcaaaagtacaatt
ggtagacatctagcacagcaactgcatatggagttcgtagactctgatacagtgatcgaa
gaacgcactggtgcagacattgcttgggtttttgatgtagaaggcgaagaaggcttccgt
aagcgcgaagaagcggtacttgaagacctaactcaagagcaaggcatcgtgctagcaaca
ggcggtggttctgttaagagcaaagaaaaccgtaaccgtctttcagcacgtggtgttgtt
gtttacctagaaacaactattgaaaagcaacttgcgcgtacaaaccgcgacaagaagcgt
cctctacttcaaactgaaaaccctcgtgaagtgttggaaagtttggcaggcgaacgtaac
cctctatacgaagaagtagcggattacacagttcgtactgacgatcagagtgcaaaagtg
gtagccaaccagatcgtaaaaatgctagaagagagataa

DBGET integrated database retrieval system