KEGG   Vibrio harveyi: AL538_07790Help
Entry
AL538_07790       CDS       T04380                                 

Definition
(GenBank) penicillin-sensitive transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
vhr  Vibrio harveyi
Pathway
vhr00550  Peptidoglycan biosynthesis
vhr01100  Metabolic pathways
vhr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL538_07790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AL538_07790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vhr01003]
    AL538_07790
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vhr01011]
    AL538_07790
Enzymes [BR:vhr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AL538_07790
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AL538_07790
Glycosyltransferases [BR:vhr01003]
 Polysaccharide
  Bacterial polysaccharide
   AL538_07790
Peptidoglycan biosynthesis and degradation proteins [BR:vhr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AL538_07790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AMF97633
UniProt: A0A454B659
LinkDB All DBs
Position
1:1647953..1650523
Genome map
AA seq 856 aa AA seqDB search
MKFIKRLLFLTLICIILGVTTIFGFYQYVKPELPDVATLKDVELQTPMQVFSQDGKLIAQ
FGEKRRIPVTYDEIPQDLIHALIATEDSRFYEHPGIDPIGITRAAVVVALSGSAKQGAST
ITQQLARNFFLSNEKKIMRKVKEIFIAIHIEQLLTKQEIMELYVNKIFLGYRSYGFGAAA
QVYFGKSLNELTLSEIATLAGMPKAPSTMNPLYSLERATKRRNVVLMRMLDEKYITQAQY
DEARAEPIVARYHSAEIELSAPYVAELARSWAVKEYGADKAYTSGLNIYMTVDSKLQDAA
NKASINNILAYDERHGYRGAEKVLWKQGEPAWDTEQIEKHLKKQPTYGQLYPAVVTKVDG
KTAQVWVKNNDEQTLAWTGMSWARKFLTDERQGAAPKSAQEILEVGQQVWVREVSTTDKD
GNTINNWKLSQVPNANTAFVAMNPENGAVLSLVGGFNFVHSKFNRATMSVRQVGSSIKPF
IYSAAINKGLTLASLVNDAPINKWDAGSGSAWRPKNSPPTYIGPTRLRIGLAQSKNVMAV
RTLREVGLDATREYLTRFGFDINEVPRSETIALGAGSLTPMKVAQGYSVFANGGYYVEPF
YIDHVEDSFGEVLFKANPKVICQHDCPQMEQEAPVEDKFAAEFGEQDIAMDEPTSDNALE
DDTPQYAKQVISAQNAFLMREMMYSNIWGGGSWRDGTGWNGTGWRAQKLERRDIGGKTGT
TNDSKDTWYNGYGPGIVAIAWVGFDDHSRTLGRTTVNSNLGKGQISGAESGAKTAEPAWI
DFMRVALEGTPQKAKNIPEDIVRVRIDRDSGLLTHKVDGSSMFEYFEKGTEPTEYVGNSL
EDSIYSGGGSGSEELF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcataaagcgtttattatttttaacattgatttgcataattcttggagtcacc
acaatttttggcttctatcagtacgtgaagcctgaattgccagatgttgcaaccctaaaa
gatgttgaattacaaacacctatgcaggtttttagtcaagatgggaaactgatcgcacag
tttggcgagaagcgccgaattcctgttacctacgacgaaattccgcaagatttgattcac
gcgctgattgcgaccgaagatagccgcttttatgagcaccctggtatcgatccaatcggt
attactcgtgctgctgttgtggtggcattatctggttctgcaaaacaaggtgcgagtacc
atcactcagcagctagcgcgtaacttcttcttatctaatgagaagaaaatcatgcgtaaa
gtgaaagagatcttcattgcgattcacattgagcagttgttgacaaaacaagagatcatg
gagctatacgttaacaagattttccttggctaccgctcttacggttttggtgcagccgct
caggtttatttcggtaagagtttgaatgaactgactctcagcgagattgctacgttagca
ggtatgccaaaagcgccatcaaccatgaacccactttactcactagagcgagcgacaaag
cgtcgtaatgtggtgttgatgcgtatgctggatgagaaatacatcactcaagcgcaatac
gatgaagcacgcgcagagccaattgtggcacgctaccatagcgctgaaatcgaactgtct
gccccatacgtcgcagaactagcacgttcttgggcagtaaaagaatacggtgcagacaaa
gcgtatacgtctggtttgaacatttacatgacggtagattccaagcttcaagacgcagca
aacaaagcatccatcaacaatatccttgcttacgatgaacgtcacggctatcgcggagca
gagaaagtactgtggaaacaaggcgaacctgcttgggatactgagcagattgagaagcat
ctgaagaagcagccaacatatggtcaactttatccagcggttgtgaccaaagtagacggt
aaaacggcacaagtttgggtgaaaaacaacgacgaacaaactctcgcttggacaggcatg
agctgggctcgtaagttcctgactgatgaacgccaaggcgcagcaccaaaatcagcgcaa
gagatcctagaagtcggccagcaagtttgggttcgcgaagtcagcacaactgacaaagat
ggcaacaccatcaacaattggaagttgagccaagtgccaaatgcaaacaccgcgtttgtc
gcaatgaacccagaaaatggtgcggtactttctctcgttggtggttttaacttcgtccat
agcaaatttaaccgtgcgaccatgtcggtccgtcaggtaggttcaagtattaagcctttc
atctactctgctgcgatcaataaaggtctaacgctggcatcattagttaacgatgctcca
atcaacaaatgggatgcaggttctggttcggcatggcgtccgaagaactcaccaccgaca
tacattggtcctactcgtctacgtatcggtttagcacaatcgaaaaacgtaatggcggtg
cgcactttgcgtgaagtaggcttagatgcgactcgcgaatacctgactcgctttggtttt
gatatcaacgaagtgccgcgttcagagactattgcgcttggtgcgggtagcttaacgccg
atgaaagtagcacaaggttactcggtctttgccaacggtggttactatgttgaaccattc
tacattgaccacgttgaagactctttcggtgaagtgctatttaaagccaatccaaaagtt
atctgtcagcatgattgccctcaaatggagcaagaagcgccggttgaagataagtttgcc
gcagagtttggcgagcaagatatcgcaatggatgagccaacatcagacaacgcattagaa
gacgatacaccacaatatgcgaagcaagttatctcagcacaaaacgcattcttaatgcgt
gagatgatgtacagcaacatttggggcggcggtagttggcgtgatggtaccggttggaac
ggtacaggttggcgcgctcagaaactcgaacgccgcgatattggcggtaagaccggtaca
accaacgattcaaaagatacatggtataacggttacggtccgggcattgtcgctattgca
tgggttggctttgacgatcactcccgcactctaggtcgaacgactgtgaacagcaacctt
ggtaaaggacagatttctggtgcggaatcgggggcgaagacagcagagccagcttggatt
gatttcatgcgcgtcgcacttgaaggtacgcctcaaaaagcgaaaaacatcccagaagat
atcgtccgtgttcgtattgatcgtgatagcggtcttctgactcataaagtcgatggttca
tccatgttcgaatattttgagaaaggaactgagccaactgagtacgtcggtaacagttta
gaagacagtatctattcaggtggtggtagcggctcagaagagttgttctaa

DBGET integrated database retrieval system