KEGG   Vibrio harveyi: AL538_07840Help
Entry
AL538_07840       CDS       T04380                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vhr  Vibrio harveyi
Pathway
vhr00620  Pyruvate metabolism
vhr00680  Methane metabolism
vhr01100  Metabolic pathways
vhr01120  Microbial metabolism in diverse environments
vhr01200  Carbon metabolism
Module
vhr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL538_07840
  09102 Energy metabolism
   00680 Methane metabolism
    AL538_07840
Enzymes [BR:vhr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL538_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF349
Motif
Other DBs
NCBI-ProteinID: AMF99405
LinkDB All DBs
Position
1:1661720..1664353
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGNNADRESLIEEI
KSLPDEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLFSKLVQNDVSKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSFKERKKTERRLEQ
LIVQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVCNDKVR
ELAGEDQHEPYRAILKQLRSLLNETKDILDAKVHGQKLAVKAPLQKVEQLWEPLYACYQS
LNECGMGVIANGSLLDTLRRVKAFGIHLVRLDIRQESTRHADVLSELTRYLGIGDYEQWS
EQDKVAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIVAAQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAEAVIKQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMDSLVKVAEEEGVELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMDVLSE
VSCEAYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSVDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNMEISRYY
DQRLVENQLLPLGDRLREQLQRDIKSVLNVENNENLMQSDPWGLESIRLRNIYVEPLNML
QAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcacttaaaagcaatgtgcgcatgttgggccaccttctgggt
aacacaattcgtgatgctcatggcgaagaaatcttcgagaaagtggaaaccattcgtaaa
ttatccaaatcggctcaagctggaaataacgctgacagagaaagcttaatagaagaaatt
aaaagcttaccagatgagcaattgacgccagtgacccgcgcgttcaaccaatttctaaac
ctgaccaatattgctgagcaataccacaccatttcacgccattgtgaagagcatatctgc
gaacctgacgcaattaattcgctgttctcaaaactagtgcaaaatgatgtgagtaagcta
gacacggcacaagcggttcgcgatctaaatattgaattagttctgacagcgcacccaacc
gaaatcactcgtcgcactatgatcaacaagcttgtaaagatcaacgagtgtctatctaag
ctagagctgagcgacctctctttcaaagagcgtaagaaaactgaacgccgtcttgagcag
ctgatcgttcaaagctggcactctgacgttattcgtcaacagcgcccgacaccgcttgat
gaagctaaatggggctttgccgtagtagaaaactcactatgggaagccgtacctgacttc
ttacgtgaaatgaacgaccgtctaaaatcataccttggcgaaggtctaccgattgatgct
cgccctgtgcacttctcatcttggatgggtggtgaccgcgacggtaacccatttgtgact
cacagcgtaactcgtgaagtactgcttctgtctcgttggaaagcggcagacctatacctc
aacgacatcaacgaactgatcagcgaactgtcaatgacagtgtgtaacgacaaagttcga
gagcttgcgggtgaagatcaacacgaaccataccgtgcgatccttaaacagctacgttcg
ctactgaacgaaacaaaagacattctcgacgcaaaagttcacggtcagaaactggcagtc
aaagcgccgctacaaaaagtagagcagctttgggaaccactttacgcgtgttaccaatca
ctaaacgaatgtggcatgggcgtgattgctaacggctcactgctggatactctacgccgt
gttaaagcattcggtatccacctagttcgtctcgatatccgtcaagaaagtacgcgtcat
gccgacgttctatctgaactgactcgttacctaggtattggagactacgaacagtggagc
gagcaagataaggtagctttcctaactaacgaactcgcatctaagcgccctcttctgcct
cgtgactgggaaccatcggaaccagttaaagaggttttggatacctgtaagattgttgca
gcacaacctcgcgaagcattcggtgcttacgttatctcaatggcgcgtaccgcttctgac
gtacttgccgtacacctactacttcaagaagcaggttgcccttaccgcatggacgtttgt
cctctgttcgaaaccctagacgatttgaacaacgcagaagcggtaatcaagcagctaatg
ggtatcgacctataccgcggctttatccaaaaccaccaaatggtgatgatcggctactct
gactctgcaaaagacgcaggcgtaatgtcagcaggttgggcgcaataccatgcgatggac
tcactggttaaggttgcagaagaagaaggcgtagaactcacactattccacggtcgtggc
ggtacgattggtcgtggtggtgctccagcacatgctgcactactatctcagccacctaag
agtctgaaaggcggcctgcgcgtaacagagcaaggcgaaatgatccgctttaagttgggt
ctacctgatgtagcagttaatagcttcaacctgtacgctagtgcaatccttgaagcaaac
ctactgccgccaccagagcctaagcaagagtggcgtgacctaatggacgtcttgtcagaa
gtaagctgcgaagcataccgtagtgtcgttcgtggcgagccagatttcgtgccttacttc
cgccaagcaacaccggagcttgagctaggtaaactgccacttggttcacgaccagcgaaa
cgtaatccaaacggtggcgtagaaagcttgcgtgcgattccatggatcttctcttggagc
caaaaccgcttggttctgccagcatggttaggcgcaggtgaggctattcagtactctgtc
gacaaaggtcatcaggcgctactggaagagatgtgtcgtgaatggccgttcttctctact
cgtctaggcatgcttgagatggtgtacaccaagtgcaacatggaaatctctcgctactat
gatcaacgcctagtggagaatcaacttctaccattaggtgatcgactacgtgagcaactc
cagcgtgatatcaagtcggtactaaacgtagagaacaacgagaacctaatgcaaagcgac
ccttggggtctagaatctattcgcctacgtaacatctacgttgagccattgaacatgctt
caagccgagttgctataccgaactcgtcaaactgaagaagcttctgccaatttagaagaa
gcattgatggtgacgattgcaggtattgcggcaggcatgcgtaatacaggttaa

DBGET integrated database retrieval system