KEGG   Vibrio harveyi: AL538_14300Help
Entry
AL538_14300       CDS       T04380                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vhr  Vibrio harveyi
Pathway
vhr00220  Arginine biosynthesis
vhr00250  Alanine, aspartate and glutamate metabolism
vhr00290  Valine, leucine and isoleucine biosynthesis
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr01130  Biosynthesis of antibiotics
vhr01210  2-Oxocarboxylic acid metabolism
vhr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL538_14300
   00290 Valine, leucine and isoleucine biosynthesis
    AL538_14300
   00220 Arginine biosynthesis
    AL538_14300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vhr01007]
    AL538_14300
Enzymes [BR:vhr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AL538_14300
    2.6.1.66  valine---pyruvate transaminase
     AL538_14300
Amino acid related enzymes [BR:vhr01007]
 Aminotransferase (transaminase)
  Class I
   AL538_14300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AMF98802
UniProt: K5TMB7
LinkDB All DBs
Position
1:complement(3034752..3035966)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGKPVHYLCDEGADWYPDLEDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLMIFADEIYDKVLYDGATHTSVATLTDDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYINGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAYELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLETAISRFERFLTTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctacgacattaggggtcct
gtactcaaacatgctaaacgcatggaggaagaagggcataaaatcctaaagctaaacatt
ggtaaccccgccccatttggttttgacgcccctgatgagattctagtagatgtaatccgt
aatctaccaacttctcaaggctattgtgattccaagggtatttactcagcacgtaaagcc
gtcgtgcagcactaccaacgtaaaggcatccgttctctggatgtggaagatgtatacgta
ggcaacggtgtttccgaactcatcgtaatggcaatgcaagcgctattgaataatggcgat
gaaatgctgatcccagcaccggattacccattgtggacggcatctgttgcgctatcaggt
ggtaagcctgttcattacttatgtgatgaaggtgcggactggtatccagatctagaagac
atcaaaaagaaaatcacgccaaaaacacgcggtattgttctcatcaacccgaacaaccca
acgggtgcggtttacagccgtgatttccttttagaagtgattgagattgcgcgtcagcat
aagttgatgatcttcgccgacgaaatctacgacaaagtactttacgacggtgcaacacac
acttctgtcgcaacacttactgacgatgtattggtaatgaccttcaacggtctgtcaaaa
gcataccgtgtttgtggtttccgcggtggttggatgttcctaacgggtcctaaacattta
gcacaaggctatatcaacggtctcgaactgctgtcttcaatgcgtttgtgtgccaacgta
ccaatgcaacatgcaatccaaaccgcgttaggcggctaccaaagtattaatgagttaatc
ctgccaggtggtcgtcttcttgaacaacgaaaccgcgcttacgaactgatcaatcagatc
cctggggtttcgtgtgtgaagccaaaaggcgcgatgtacttgttcccgaaaatcgacacc
aagatgtacaacatcaaaaatgaccaacaaatggtcttggatttcttaaaacaagagaag
gtattgttggtacaaggctctggcttcaactggccaaaacccgatcacttccgtatcgtg
actttaccccacgtagaagatctcgaaaccgcgattagtcgctttgaacggttcttaaca
acgtatagccagtag

DBGET integrated database retrieval system