KEGG   Vibrio harveyi: AL538_16295Help
Entry
AL538_16295       CDS       T04380                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vhr  Vibrio harveyi
Pathway
vhr00250  Alanine, aspartate and glutamate metabolism
vhr00410  beta-Alanine metabolism
vhr00430  Taurine and hypotaurine metabolism
vhr00650  Butanoate metabolism
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr01120  Microbial metabolism in diverse environments
vhr02024  Quorum sensing
Module
vhr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL538_16295 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL538_16295 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL538_16295 (panP)
   00430 Taurine and hypotaurine metabolism
    AL538_16295 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL538_16295 (panP)
Enzymes [BR:vhr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AL538_16295 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 Aminotran_1_2 AAA_33 FAD-SLDH HSCB_C DUF5446
Motif
Other DBs
NCBI-ProteinID: AMF99172
LinkDB All DBs
Position
1:complement(3489662..3491308)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTIPEGPDSTLTKIDESLSQNLNKFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQDDKFYRKWMHSAKHSLGAFCSGGTIANITA
LWVARNKALRADGAFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKAKIAELESQSIKPIAVVGVAGTTETGSVDPLPQIAEVCAEHD
CHFHVDAAWGGATLMSNNHRHLLGGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIAKARYFADL
INEQEDFELVSEPELCLLTYRYLPTNMRAALEKAQGTQKEKLNELLNQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTNDILSAVLDEQREIAQQAPSLMAKIEE
TVDDILNS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagcttcgagagcttgttaaagatcttcaca
attcctgaaggtccagattctacattgaccaaaatcgacgagagtctctcccagaacttg
aacaaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaattgagaaa
gacttttcttctgctcagattcctgagcaaccagagttcgtgtcagaccataccgagcac
ctactagataccttggtatctcactcggttcatacatctgcgccaagctttattggtcac
atgacttctgccctgccgtatttcttaatgccgctgtcgaagatcatgatcgccttgaac
caaaacttggtaaagattgaaacttcgaaagcattcacaccacttgaacgccaagtactt
ggtatgctgcatcgccttatttatggtcaggacgacaagttctaccgtaagtggatgcac
agcgcgaagcactctctcggtgcattttgttctggcggtaccatcgcgaacattactgcg
ctttgggttgctcgcaataaagcactaagagcagatggcgcattcaaaggtgtagaaaaa
gaaggtctgttcaaagccatgaaacattatggctatgaaggactcgcaattctggtttct
gagcgtgggcattactcactgaagaaagctgccgacgtacttgggcttggtcaagaagga
ttagttgccgtcaaaacagacgcaaacaaccgcattatcgttgatgacttgaaagcaaaa
attgcggaacttgagtcgcaaagtatcaagcctattgcggtggttggtgttgctggtacg
acagaaaccggtagcgttgacccgcttcctcaaatcgctgaagtgtgtgctgaacacgat
tgtcacttccatgtggatgcagcatggggtggtgcgacactgatgtcgaacaatcatcgt
cacctacttggtggggtcgaacttgcagattctgtgacgattgacgcgcataaacaactc
tacatccctatgggtgcaggtatggttctgtttaaagacccagatgcgatgaagtctatc
gagcaccacgcacaatacattttgcgtaagggctcaaaagacctaggtagccacaccctt
gaaggctctcgctccggtatggcgatgttggtttacgcggcaatgcatatcattagccga
cctggttatgaactgctgattgaccagagtatcgccaaagcgcgctacttcgctgatctt
attaacgagcaagaggactttgagttagtgtctgagcctgagctttgtctgctgacttac
cgttatttgccaaccaatatgcgcgcagcattagagaaagcacaaggtacgcagaaagag
aaactgaatgagttactcaaccaactgactcagtttatccaaaagcgccagcgtgaaaca
ggtaagtcctttgtgtcacgtactcgactgaacccagaccaatggcaacgcatgaacacc
attgtattccgtgttgtgttagcgaacccattgacgaccaatgacattctaagtgcggta
ttggacgagcagcgcgaaattgctcaacaagccccaagcttaatggcaaaaattgaagaa
actgtcgacgacattctcaattcttaa

DBGET integrated database retrieval system