KEGG   Vibrio harveyi: AL538_18135Help
Entry
AL538_18135       CDS       T04380                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vhr  Vibrio harveyi
Pathway
vhr00550  Peptidoglycan biosynthesis
vhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL538_18135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vhr01002]
    AL538_18135
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vhr01011]
    AL538_18135
Enzymes [BR:vhr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AL538_18135
Peptidases and inhibitors [BR:vhr01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AL538_18135
Peptidoglycan biosynthesis and degradation proteins [BR:vhr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AL538_18135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AMF99647
UniProt: A0A3A1Q7K6
LinkDB All DBs
Position
2:complement(215192..216337)
Genome map
AA seq 381 aa AA seqDB search
MTLACLLLQTISAPALAVVTPNPPQLQAKGYVLMDFQSGAIIAEQNARAGLAPASLTKLM
TAYVVGQEIKSGRLQWDDKVTVSENAWSAKFPDSSKMFIQPKDEITVANLMRGVIIQSGN
DACVALAEHVAGSEGAFVALMNGWADKLSLNDTYFVNSHGLDSEGIQTSPNDMATLMQSI
INDVPEVYALYSEKVFKWNKITQYNRNKLLWDKSMDVDGGKTGYTSNAGYSLVSSAKQGK
MRLISVVMGTPSKQSRISQSKNLLSYGFRFYDTKQVAKQGEVQASAKVWKGDVSEIDLGF
AQDAYLTLPRSLTAGLDKSVVVNEPLIAPIAKGDVVGKVVWKSDDKTVASYPLVSNQAVE
EGSWIGKLWDSLVLWVKSLFN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atcacgctcgcttgtttattactacagaccatcagtgcccctgcattggcagttgtaacg
ccgaatccgcctcagttgcaggcgaaaggctatgtgttaatggactttcagtccggtgcc
atcattgcggagcaaaacgcgcgtgccggattagcccctgccagtttaaccaagctgatg
accgcttacgtcgtggggcaagaaatcaaatccgggcggcttcaatgggatgataaagtg
acggtgagtgagaacgcgtggtcagccaaattcccagactcctcaaaaatgtttattcaa
cccaaagatgaaatcaccgtcgctaatctaatgcgtggtgtgatcattcaatcagggaat
gatgcttgtgtggcgcttgctgaacatgttgcaggtagtgaaggggcgtttgtcgccttg
atgaatggttgggcggataagctcagcttgaacgatacctacttcgttaactcgcatggt
ctggatagcgagggtattcaaacttctcctaatgatatggcgacgctgatgcaatccatc
atcaatgacgtgcccgaagtctatgcgctttatagtgagaaggtatttaagtggaacaag
atcacccaatacaaccgtaataaactgttgtgggacaaatcgatggatgtcgatggcggt
aaaacgggctacaccagcaatgcagggtacagtttggtcagttctgctaagcaaggaaag
atgcgacttatctcggtagtgatggggacaccaagcaaacagtcacgcattagtcagtct
aagaatctactcagctatggcttccgcttctatgacactaaacaagtggcaaaacagggg
gaagttcaggcgagtgcaaaagtctggaaaggcgatgtcagtgagattgatttgggcttc
gctcaagatgcgtacctgacgctgcctcgctctctaaccgctggtttagataaaagcgtg
gtcgtgaatgagccgttgattgctcccatcgcaaaaggggatgtggttggtaaagtcgtg
tggaagagtgacgataaaaccgtggcgagctatccgttggtaagtaaccaagcagtggaa
gagggctcgtggattgggaagttatgggacagtttggtgctgtgggtgaagtcgctgttt
aactag

DBGET integrated database retrieval system