KEGG   Vibrio harveyi: AL538_26505Help
Entry
AL538_26505       CDS       T04380                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vhr  Vibrio harveyi
Pathway
vhr00500  Starch and sucrose metabolism
vhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL538_26505
Enzymes [BR:vhr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL538_26505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Cyc-maltodext_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AMG01210
LinkDB All DBs
Position
2:complement(2122067..2123416)
Genome map
AA seq 449 aa AA seqDB search
MSGLQETLSTGANVILHAFDWKYADIAQRASEISELGYGSVLVSPPMKSAQDERWWQRYQ
PQDYRIIDNALGNTVDFKNMIEALNHVGVLVYADVVFNHMANEAHLRPDLQYPRQGVMDD
YQQNASKYQDLILFGDLSEPLFDENDFVEAFGIKDWKDKWQVQNGRITGGPTDPGLPTLR
VCKHVVEQQKAYLKALKSMGVKGFRIDAAKHMTLEHLKLVWTEEITRDVHIFGEIITDGG
ATEEEYELFLEPYLKETRLGAYDFPLFSTIFKAFSKKGSFKSLIDPYCFGQALSNRRAIT
FAITHDIPNNDVFLDLVMDEENEWLAYAYILGRDGGVPLVYTDLDTSGIKGADGRPRWQN
AWQDARMAKMVAFHNLVHGEPMTVLEGNDDMLVLQRGEKGILVLNKSSRAQSLQLTLNKA
LVDMMTGEEMPCTEEIKVAAKSAMLLVEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaacactatcaacaggtgcaaatgttatcttgcacgcttttgat
tggaagtatgctgacattgcccaacgcgcatcggaaatcagcgagctaggttatggctcg
gtgttggtttctccaccgatgaaaagcgcacaagacgaacgctggtggcagcgttaccaa
cctcaagattatcggattatcgacaatgcactcggtaacacagtagatttcaaaaacatg
attgaagcactcaatcatgtaggcgtactggtttatgccgatgtcgtttttaatcatatg
gcgaacgaagcgcaccttcgtccggatctacagtatccacgtcaaggcgtgatggacgac
taccaacaaaatgcgagcaagtatcaagacctgattctatttggcgatttatctgagccg
ctatttgacgaaaatgactttgttgaagcctttgggatcaaagattggaaagacaaatgg
caagtgcaaaacggtcgaatcactggtggtcctaccgatcctggcttaccaactttgcgt
gtatgtaagcacgttgttgagcagcaaaaagcgtatttaaaggcgcttaagtcaatgggt
gtgaaaggtttccgtatcgatgctgcgaagcatatgaccctagagcacctaaagctggtt
tggacagaagagatcacgcgagatgtgcatatctttggtgagatcatcaccgatggtggc
gcaacagaagaagagtatgagctgttcttggaaccgtatttgaaagagacacgattgggt
gcatatgactttccgttgttctcaaccatctttaaggcgttctcaaagaaaggcagcttt
aagtctttgatcgacccgtactgttttggtcaagcgttgtcgaaccgtcgagccattact
tttgccatcactcacgatattccaaataacgatgtgttcttggatttagtcatggatgaa
gagaatgagtggctagcgtatgcctatatcctaggccgtgatggaggtgtaccacttgtt
tacacagatttggataccagtggcataaagggcgccgatggtcgaccaagatggcaaaat
gcgtggcaagatgcgcgtatggcgaagatggtagcgttccataacctagtgcatggtgaa
ccgatgacggtgcttgaaggtaacgacgatatgttggtgttgcaacgtggtgaaaagggc
atcttagtgctgaataaatcttcacgagcgcaatcactacaacttaccttgaataaagcc
ttggtagacatgatgacaggcgaagagatgccttgtactgaagagattaaagtggcagca
aaatcggcgatgctgcttgtagagaaataa

DBGET integrated database retrieval system