KEGG   Virgibacillus sp. 6R: BKP57_02250Help
Entry
BKP57_02250       CDS       T04596                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00020  Citrate cycle (TCA cycle)
vig00190  Oxidative phosphorylation
vig00650  Butanoate metabolism
vig01100  Metabolic pathways
vig01110  Biosynthesis of secondary metabolites
vig01120  Microbial metabolism in diverse environments
vig01130  Biosynthesis of antibiotics
vig01200  Carbon metabolism
Module
vig_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vig_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKP57_02250
   00650 Butanoate metabolism
    BKP57_02250
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BKP57_02250
Enzymes [BR:vig01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BKP57_02250
    1.3.5.4  fumarate reductase (quinol)
     BKP57_02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_16 Fer4_3 Fer4_13 Fer4_18 Fer4_4 Fer4_20 Fer4_21 zf-ANAPC11 Fer4_15 Fer4_6
Motif
Other DBs
NCBI-ProteinID: API90777
LinkDB All DBs
Position
complement(463738..464502)
Genome map
AA seq 254 aa AA seqDB search
MADNKTITFIITRQDSPDSNSYKETFKVPYKPNMNVISALMEIRQNPVNANGEKTTPVQW
DMNCLEEVCGACSMVINGVARQSCAALVDQLDHPIRLEPMSTFPVVRDLIVDRERMFDAL
KQVKAWIPIDGTHDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNDKSNFIGPAAI
SQARLFNAHPTGAMNASERLNGLMEDGGIDGCGNSQNCVQVCPKGIPLTTSIAAMNRATN
IQAFKNFFGSDNAH
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgataataaaacaattacgtttattataactcgacaagacagccctgattctaac
tcctataaagaaacgtttaaagtaccatataagccaaatatgaacgttatttctgcattg
atggaaattagacaaaatccggttaatgcaaatggggagaaaacgacaccagtacaatgg
gatatgaactgtctcgaagaagtatgtggtgcatgttccatggtgatcaatggggttgca
agacaatcttgtgcagcactcgtggatcagcttgaccatccgatccgcttagagccaatg
tcaacatttccagttgttcgtgatttaatcgttgaccgcgaacgcatgtttgatgcgtta
aaacaagtgaaagcgtggataccaatcgatggtacacatgatttaggtcctggtccacgt
atgcccgaaaagaaacgccaatgggcttacgaattatctaaatgtatgacatgtggcgtc
tgtttggaggcttgtccaaatgtgaatgacaaatccaatttcattggacctgctgccata
tcacaagctcgtttgtttaacgcacatccaaccggagcgatgaatgcaagtgaacggtta
aatggattgatggaagacgggggtattgatggttgcggaaactcgcaaaattgtgtgcaa
gtatgccctaaaggtattccattaacaacctctattgctgcaatgaaccgagctacaaac
attcaagcgtttaaaaacttctttggaagtgacaacgcacattaa

DBGET integrated database retrieval system