KEGG   Virgibacillus sp. 6R: BKP57_02255Help
Entry
BKP57_02255       CDS       T04596                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00020  Citrate cycle (TCA cycle)
vig00190  Oxidative phosphorylation
vig00650  Butanoate metabolism
vig01100  Metabolic pathways
vig01110  Biosynthesis of secondary metabolites
vig01120  Microbial metabolism in diverse environments
vig01130  Biosynthesis of antibiotics
vig01200  Carbon metabolism
Module
vig_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vig_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKP57_02255
   00650 Butanoate metabolism
    BKP57_02255
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BKP57_02255
Enzymes [BR:vig01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BKP57_02255
    1.3.5.4  fumarate reductase (quinol)
     BKP57_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: API90778
LinkDB All DBs
Position
complement(464505..466268)
Genome map
AA seq 587 aa AA seqDB search
MNKRKIAVVGGGLAGLMATIKAAEAGVSVDLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWLHFDDTVYGGDFLANQPQVKAMCDAAPGIIHMFDRMGVMFNRTPEGLLDFRRFGGTQ
MHRTAYAGATTGQQLLYAVDEQVRRYEVEGLVTKYENWEFVRAVIDEEGVGRGIVAQNVK
THEIKAFPSDATIFATGGPGIIFGKSTNSMINTGSAASKLYQQGAKYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGEPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFVGEDPRKVPMKIFPAVHYSMGGLWV
DINQMTNIPGIFAAGECDYSQHGANRLGANSLLSAIYGGAVAGPKAMEYIEGLDKHVDDL
SANLFEENVKVEQDNFDKLMSMDGEENAYQLHKELGQWMTDNVTVVRENKKLLETDEKIQ
ELLQRFENININDTSRWSNQGVMFTRQLENMLHLARVITQGAYNRNESRGAHYKPEFPDR
NDEDWLKTTIAEFDMEEKAPKFSYEDVDISLIKPRKRDYTKKSEGSK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacgaaaaattgccgtagttggcggaggtttggctggcttaatggcaacaata
aaagcagcagaagcaggagtaagtgttgatttattttcaattgttcctgtaaagcgctct
cactctgtatgtgctcaaggtggaataaatggtgcagtcaatacgaaaggggaaggagac
tctccttggcttcactttgatgatacagtgtatggtggagatttcttggcaaatcagccg
caagtaaaagcgatgtgtgacgcagcacctggaattatacacatgtttgatcgtatgggt
gttatgtttaaccgtacaccggaaggattgctggactttcgccgatttggtggaacacaa
atgcacagaacagcatatgcaggggcaaccacagggcaacaattgctttatgcggtagat
gaacaagtacgtcgctatgaagtagagggccttgttacaaaatatgaaaactgggaattt
gttcgggcggtaattgatgaagaaggcgttggtagaggaatcgtagctcaaaatgtgaaa
acacacgagatcaaagcattcccgtctgacgcaactatttttgccactggtggacctgga
attatcttcggtaaatctaccaattcaatgattaatacaggatctgctgccagcaaattg
tatcagcaaggggcaaaatatgcgaatggcgaatttattcaaattcatccaactgccatc
ccaggtgatgataaattacgattaatgagtgaatctgctcgtggtgaaggtggcagaatt
tggacatataaagatggagagccatggtatttcttagaagagaaatatccagcttatgga
aaccttgtaccaagagatatcgcaacacgtgaaatatttgatgtatgtgttaatcaaaag
cttggtattaacggtgaaaacatggtgtatttggatctatctcataaagatccgaaagag
ttagatataaagctaggcggaattattgagatttatgagaaatttgttggcgaagatcct
cgaaaagtgccgatgaaaatcttccctgctgtccattattctatgggtggactgtgggtt
gatattaatcaaatgactaatattcctgggatttttgctgcgggagaatgtgattattcg
cagcatggtgctaatcgacttggtgctaactcactattgtcggccatttatggtggggct
gttgctggtccaaaagcaatggagtatattgaaggtttagataaacatgtggatgatttg
tcagctaacttatttgaagaaaatgtaaaagttgaacaagataactttgataagttaatg
agcatggatggcgaagaaaatgcctatcaacttcataaagagcttggtcagtggatgacc
gacaatgttaccgtagtgcgtgagaataagaaattactagaaacagatgaaaagattcaa
gagctactacagcgttttgaaaacattaatattaatgatacatctcgttggagcaaccaa
ggtgtcatgtttacacgtcaactggaaaacatgcttcatctagctcgtgtcattacacaa
ggcgcttataatcgaaatgagagtcgcggtgcgcattataagccagaatttccggacaga
aatgatgaagactggttaaaaaccactattgcagagtttgatatggaagaaaaggcacca
aagttttcttatgaggatgtcgatatttcattaattaagcctcgtaagcgcgactacacg
aaaaaaagcgaagggagtaagtaa

DBGET integrated database retrieval system