KEGG   Virgibacillus sp. 6R: BKP57_04795Help
Entry
BKP57_04795       CDS       T04596                                 

Definition
(GenBank) thiol reductant ABC exporter subunit CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
vig  Virgibacillus sp. 6R
Pathway
vig02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vig00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BKP57_04795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vig02000]
    BKP57_04795
Transporters [BR:vig02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BKP57_04795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 RsgA_GTPase AAA_16 OATP DUF87 MMR_HSR1 ATP-synt_ab AAA_29 AAA_5 Rop-like
Motif
Other DBs
NCBI-ProteinID: API91237
LinkDB All DBs
Position
1061188..1062939
Genome map
AA seq 583 aa AA seqDB search
MRTWIIPYVKMHYKGLLASILIGLLALACGAALMFTSGYLISKSALRPENILMVYIPVVS
VRAFGIFRAVFHYLSRLTSHNTILRILANMRSRLYQTLEPQAAFIQSRFQTGRILGVLSD
DIDHLQDLFIRTILPSATALGMYGIVIAYLGWFDIVFALLMAVYLFFIVVFIPILSLWSS
RKRTALIKNGRYDQYHILTDGLLGIKDWMIAGKPNDFMKQDTMKDQSVAIVERRIKSQQR
FRDFANQLIIGAMVISMVYWSSTMVAEGNMHVTLIAAFVLVTLAIAEAFLPVSEALEQVP
EYTESISRLEALEETDAGKATSQQNVSLSAVPRSVDILLDHVAFQYPGFDKQVLKDVSIA
IPQGKRLALLGKSGVGKSSIVQLICGSYAPTKGTVTLNGTDATAYGDALFEMVSILNQQP
HLFNTTIANNLRLGNQQATDQNIVEAAKKVQLHDYIKSLPKGYNTMMEESGQIFSGGQQQ
RVALARILLKGTPVVILDEPTVGLDPKTEADLLKTIFSTLKDKTVIWITHHLSGIKHMDE
IIFLEDGYIEMQGSHQELLTTSQRYQDLYYLDVPPSIRKMVQL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttggatcatcccatatgtaaaaatgcattataaagggttattagccagcatt
cttataggtttattggctctagcctgtggcgcagcgcttatgtttacatctggatactta
atttccaaatccgcattaagacctgagaatattttaatggtttatattcccgttgtgtcc
gtccgagcttttggtattttccgggcagtatttcactatctttctcgtttaacgagtcat
aacacgatccttcgaatattagcgaatatgcgtagccgcctttatcaaaccctagaaccg
caagcagcttttattcagtcacgctttcaaactggcagaattctaggagtattatcggat
gatatcgaccatttacaagatttatttattcgaaccattttaccaagtgctactgcttta
ggtatgtatggtattgttattgcttatctaggatggtttgatattgtttttgctttactt
atggcagtgtatctattttttatcgttgtgtttattcctattctttcactatggtccagc
cgaaaacgaaccgctttaataaagaacggtcgttatgatcaatatcatatactgacagat
ggattacttgggattaaagattggatgatcgctggaaaaccaaatgattttatgaaacaa
gatacaatgaaagaccaatctgtagctattgtagaaaggcgcattaaaagccagcaacga
tttcgagacttcgccaatcaactcattattggcgctatggttatttctatggtttactgg
tcaagtacgatggttgctgaaggaaatatgcatgttacattaattgccgcctttgttctc
gttacactagccattgctgaagcttttttaccagtttctgaagcattagaacaagttcca
gagtataccgaatccatttccagattggaagcactggaagaaacagatgctggaaaagct
acttctcagcaaaacgtttctttatcagcagtccctcgttctgtagatattctgcttgat
catgttgcttttcaatatcctggatttgataaacaagttttaaaagatgtatccattgca
ataccacaagggaaaagactcgctttattaggaaaaagcggagtaggaaaatcaagtatt
gtccagcttatttgtggatcctatgccccaacaaaaggaacagtaactctcaatggaaca
gatgcaacagcttatggtgatgctctatttgaaatggtatcgattttaaatcagcaacca
catttatttaacacgacaattgctaataatcttcgccttggcaatcaacaggcaaccgac
cagaacattgtcgaagcggctaaaaaagttcagcttcatgattatatcaagagcctaccc
aaagggtataatacaatgatggaagaatcgggacaaatctttagtggcggtcagcaacaa
cgggtggctttagctagaattctattaaaaggaacccccgtcgttatacttgatgaacca
accgtaggcctagatcctaaaacagaggcagatttgttaaaaaccattttctcgacattg
aaagataaaacagttatttggatcactcaccatttatctggcattaagcatatggatgaa
attattttcttagaggatgggtatattgagatgcaaggctcacaccaagaattgttaact
acttcacagcgataccaagatttatattatttggacgtacctccatcgattcgaaaaatg
gttcaactttaa

DBGET integrated database retrieval system