KEGG   Virgibacillus sp. 6R: BKP57_05910Help
Entry
BKP57_05910       CDS       T04596                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00970  Aminoacyl-tRNA biosynthesis
vig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vig00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKP57_05910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vig03029]
    BKP57_05910
Enzymes [BR:vig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BKP57_05910
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BKP57_05910
Mitochondrial biogenesis [BR:vig03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BKP57_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: API91418
LinkDB All DBs
Position
complement(1320418..1321848)
Genome map
AA seq 476 aa AA seqDB search
MNFETIIGLEVHVELKTKSKIFSPSTNEFGTAPNTNVNPIDLGYPGVLPVLNEEAVNFAM
KAAMALNCDIATHTKFDRKNYFYPDNPKAYQISQFDQPIGENGWIEIEVHGKKKRIGITR
LHLEEDAGKLTHGDDGYSLVDFNRQGTPLIEIVSEPDMRSPEEAYAYLEKLKNIIQYTGV
SDVKMQEGSLRCDANISLRPIGQEEFGTKTELKNLNSFSFVQKGLEFEEKRQEKELLSGG
KILQETRRYDEKTKETILMRVKEGSDDYRYFPEPDLVPLYIDEAWKERIRKEIPELPDAR
KKRYMEELELPEYDATVITNSKQMADFFEEAIAHGADMKQVSNWLMGEISAYMNKHYKEL
DELAITPEALAKMIQLIDDGTISSKIAKKVFAELVENGGDPEKIVKEKGLVQISDEGQLK
EIISKVLDENEQSIIDYKNGKNKAVGFLVGQVMKATKGQANPPMVNKILLEEINKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacaatcattggcttagaggtacacgttgaattaaaaacaaagtcgaaa
atctttagtcctagtactaatgagtttgggacagctccaaacacaaacgtgaatccaatc
gatttgggatatccaggtgttttgcctgtattgaacgaagaagcggttaattttgcaatg
aaagcagcaatggctttaaattgtgatattgcgactcatacgaaatttgatcgcaaaaat
tacttctatccggacaatccaaaggcttatcaaatttcacaatttgatcaaccaattggc
gagaatggttggattgaaattgaagtgcatggaaagaaaaaacggatcggcattacacga
cttcatctggaagaagatgcgggtaaactaacacatggtgatgatggttattcgttggtt
gattttaatcgtcaaggcacaccattaattgaaattgtttccgaaccagatatgcgttcg
ccagaagaagcttatgcgtatctagaaaaactcaaaaacattattcaatatactggtgtg
tccgatgtgaaaatgcaggaagggtctttacgctgtgatgcgaatatttctttacgtcca
attggccaagaagaattcggaacaaaaacggagctaaagaatttgaactcctttagcttt
gtgcaaaaaggattagaatttgaagaaaaacgtcaagagaaagaattgctttcaggagga
aaaatcctgcaagaaacacgtcgttacgatgaaaaaaccaaggaaacgatcctcatgcgt
gttaaggaaggttcggatgattaccgttatttccctgagcctgacctagttccattgtat
attgatgaggcttggaaggagcgcattcgtaaagaaattccagagctgcctgatgcacgt
aaaaaacgatatatggaagagcttgagttgcctgaatatgatgctaccgtgattaccaat
tccaaacagatggctgatttctttgaagaagctatcgctcacggggctgatatgaagcaa
gtttctaattggcttatgggtgaaatttcggcttatatgaacaagcattataaagagctg
gatgaattagctattacgccagaagcgcttgccaaaatgattcagctcattgatgatgga
accatttcttccaagatcgctaagaaagtgttcgcagagttagtggaaaatggtggcgat
ccggagaagattgtaaaagaaaaaggtcttgttcaaatttctgacgaaggtcaattgaaa
gaaattatttctaaagtgcttgatgaaaatgaacaatcaattatcgattataaaaatggt
aaaaataaagcagttggtttcttagtcggtcaagtgatgaaagctactaaaggacaagca
aatccaccaatggttaacaaaattttattagaagaaataaacaaacgataa

DBGET integrated database retrieval system