KEGG   Virgibacillus sp. 6R: BKP57_08350Help
Entry
BKP57_08350       CDS       T04596                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00240  Pyrimidine metabolism
vig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BKP57_08350
Enzymes [BR:vig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BKP57_08350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK DNA_ligase_ZBD IMPDH
Motif
Other DBs
NCBI-ProteinID: API91838
LinkDB All DBs
Position
complement(1867747..1868367)
Genome map
AA seq 206 aa AA seqDB search
MYVMKQSGWVELICGSMFSGKSEELIRRVRRATYANLVVRVFKPAIDDRYKKEAVVSHNG
ASIIARPIKAVEDLMEHIDENVDIVGIDEAQFFDASIVTIVEQLADMGIRVIVAGLDTDF
RGEPFGSMPELMALSESVTKLNAICPICGSPASRTQRLINGQPASYDDPIILVGASESYE
PRCRHHHEVPNKPNPVVHTRLSKLMK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtaatgaaacaaagtggctgggtagaattgatttgtgggagtatgttttcaggg
aaatctgaggaattgattcgccgggttcgacgtgctacatacgctaacttagtagtccgt
gtctttaagccagcgattgatgatcgatataaaaaagaggcagttgtttctcacaatggt
gcatctattatagcacgacctataaaagctgtagaagatttaatggagcatatcgatgag
aatgtggacattgttggtatagacgaagcgcaattttttgatgcttcgattgttactatc
gtagaacagttagcggatatggggattcgcgttattgtagctggcttagatactgatttt
cgtggagaaccttttggctcgatgcctgaattaatggcgttaagtgaatcggtcaccaaa
ttaaatgctatttgcccaatatgtggttcaccagcaagtaggacgcagcgtttaattaat
ggacaaccagcttcttatgacgatccaattatattagttggcgcttccgagtcctatgag
cctagatgtcgccaccaccatgaagtaccaaataaaccaaatcctgttgtccatacgcgt
ttgtcaaagctaatgaaatag

DBGET integrated database retrieval system