KEGG   Virgibacillus sp. 6R: BKP57_10760Help
Entry
BKP57_10760       CDS       T04596                                 

Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
vig  Virgibacillus sp. 6R
Pathway
vig02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vig00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BKP57_10760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vig02000]
    BKP57_10760
Transporters [BR:vig02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BKP57_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_21 ResIII AAA AAA_7 TniB IstB_IS21 AAA_16 RsgA_GTPase AAA_5 Mg_chelatase RNA_helicase Sigma54_activat DUF2075 CbiA NACHT AAA_15 ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: API92270
LinkDB All DBs
Position
complement(2433922..2434956)
Genome map
AA seq 344 aa AA seqDB search
MSQKQQAQSVLEIKNLHTGFLIDNELHHAVMDVSFNVNSKEIVCVVGESGCGKSVMSLSI
MQLLPKTNSKISAGEVIFNGEDLVQKSEKEMNQIRGKDIAMIFQEPMTALNPVFSIGWQL
REVLFNHLEISKQKATNKAIDLLKQVGISRPEKIMDEYPHQLSGGMRQRVIIAMAIALQP
KLLIADEPTTALDVTIQAQILELLKGIQNQVNMAIMLITHDLGVVAEMADRVIVMYAGQI
VEKAGVVELFTKPKHPYTQSLLESIPKMDKTVEKLNTIDGIVPSLDNMPEVGCRFAGRCP
KAFGDCPLITPQLAEVAAGQYARCLLFDECYPHKTSRIKEVEKV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcagaaacaacaagcccaaagcgtacttgaaattaaaaatttacatacaggtttt
ttaatagataatgaattacatcatgccgtaatggatgtgagttttaacgtcaactctaaa
gaaattgtttgcgtcgttggcgaatcaggatgtggaaaaagtgttatgtcattatctatt
atgcagcttcttccaaagacaaattctaagatttctgcaggagaagttatttttaatgga
gaagatctggtccaaaagtcggaaaaggaaatgaaccaaattcgtggtaaagatattgca
atgatttttcaagaacctatgacagcattaaatcctgttttttcgattggctggcagttg
agggaggttttatttaatcatttggaaatatccaagcaaaaagctacaaataaagccatt
gacctgttgaaacaagtaggaatatcccgtccagaaaaaattatggatgaatatccgcac
caactatctggtgggatgcgtcagcgtgtcattatcgctatggcgattgcactgcagccc
aaactattaattgcagatgaaccaacaacagcattggatgtaacgattcaggcacaaata
ctagagcttcttaaaggtatacaaaatcaagtcaacatggcaattatgctcatcactcat
gatttaggtgtcgttgcagagatggccgatagagtaatcgttatgtatgctggacaaatc
gtagaaaaggctggtgtcgttgaattatttacaaaacctaaacatccgtatacgcagtca
ttgctggaaagtataccaaagatggataagacagtggaaaaactaaacaccattgatggt
atagtaccttcattggataatatgcctgaagtaggttgccgttttgctggcagatgtcca
aaagcattcggagattgcccgcttataacaccacaacttgctgaagtggctgccggtcaa
tatgcacgctgcctcttatttgatgaatgttatccacataagacatcacgtattaaggag
gtagaaaaggtatga

DBGET integrated database retrieval system