KEGG   Virgibacillus sp. 6R: BKP57_14300Help
Entry
BKP57_14300       CDS       T04596                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00473  D-Alanine metabolism
vig00550  Peptidoglycan biosynthesis
vig01100  Metabolic pathways
vig01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BKP57_14300
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKP57_14300
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BKP57_14300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vig01011]
    BKP57_14300
Enzymes [BR:vig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BKP57_14300
Peptidoglycan biosynthesis and degradation proteins [BR:vig01011]
 Precursor biosynthesis
  Amino acid ligase
   BKP57_14300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: API92876
LinkDB All DBs
Position
3188748..3189848
Genome map
AA seq 366 aa AA seqDB search
MEKKKVGIIFGGKSAEHEVSLQSAKNIVDAIDRDKFEVVLIGIDKEGKWHLNEPSSYLLH
ADNPKLIQLNKSNETVAIVPGEKEKPFIQTSNAAKLDELDVVFPIVHGTLGEDGSLQGML
RLADLPFVGPDVLASSVCMDKDIAKRLLQAAGINVANGIVYRKNEQQEIDYETVAEQLGT
PMFIKPANQGSSVGISKVTTEEEFYQGVKEAFNYDHKIVIEECIIGREIECSVLGNEEPK
ASLLGEILPQTEFYSYESKYIDEKGADLAIPADVSEETTKRVQEIAIQAFKVLECEGLAR
VDFFLTEAGEIYLNEVNTLPGFTKISMYPKLWEVSGLSYQDLITTLIELAIDRHKQDHQL
KSSLWD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaaagtagggattatttttggaggaaaatctgctgaacatgaagtgtca
cttcaatcagctaaaaatattgtcgatgcgattgatcgcgataaatttgaggttgtttta
attgggattgataaagaagggaaatggcatttaaatgagccgtcctcctatttgctgcac
gcagataatccgaaactaattcaattaaacaaatcgaacgaaacagtggcaattgttcca
ggagagaaagaaaaaccgtttattcaaacttccaatgcagcaaagcttgatgaattggat
gttgtatttccgattgttcatgggacattgggtgaggatggcagcttgcaaggaatgcta
cgtttagcagatcttccatttgtaggtccagacgttttagcgtcttccgtgtgtatggat
aaagatatcgctaagcgtttattacaggcagctggaataaacgttgcaaacgggattgtt
taccggaaaaatgaacagcaagagattgattatgaaacagttgctgaacagttaggaaca
ccgatgtttattaaaccagccaatcaggggtcgtctgttggaattagtaaagtgacgaca
gaagaagaattctaccaaggtgttaaagaagcatttaattatgatcataaaattgttatc
gaagagtgtattattggcagagaaatagagtgttctgtattaggaaacgaggaaccaaag
gcctcattactaggggagattttaccgcaaacagagttttattcctatgaatccaaatac
attgatgaaaaaggggccgatttagcgattccagctgatgtttcagaggagacaacaaag
cgggtacaagagattgctattcaggcgtttaaagtattagaatgcgaagggttggcaaga
gtggacttcttcttaacagaagcaggcgagatttatctaaatgaagtaaatacattacca
ggatttaccaaaattagtatgtatccaaagctgtgggaagtaagcggactttcctaccaa
gatttaattactacattgattgaattagcaattgatcgccataaacaggatcatcaattg
aaaagctcactttgggattaa

DBGET integrated database retrieval system