KEGG   Virgibacillus sp. 6R: BKP57_18705Help
Entry
BKP57_18705       CDS       T04596                                 

Definition
(GenBank) type VII secretion protein EsaA
Organism
vig  Virgibacillus sp. 6R
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5504 ATP-synt_D Nbl1_Borealin_N
Motif
Other DBs
NCBI-ProteinID: API93665
LinkDB All DBs
Position
4220403..4223933
Genome map
AA seq 1176 aa AA seqDB search
MKKLDKRWFLFLLLIVILASGLSYLALNQQEQTDNEETEVERAMAIALVNEDEGSMLNGE
KIAFGDAFVQGVNNENNHEWFVVSRGVAESGLKRGTYDMMIVIPNDFSQKALSIDSESPE
QVVLNYKINATDNEQIRAEAEKTASNILNRFNRRIIDVYFASIVGNLQNAQDNIGEIIEK
QAVYTNTLSNEVYNPLDNYTNQFGSIKDSTELSKSSFQSFQDMMDTFENELVADAELDQD
YLSTVNDVTQLKKKNNVQILEFYQTLNEFDGVLNQQEAEQQLERLQLANKMINDQLQNNG
GGMEEIEPPINSVMYQRNTEANIAVGANTLKKYLDDSLAQVQKTYSNIERRINPDYSGGF
TGVISDRLDGLLANVLGKEDKLVNMLLQKPAANAKNYLHKQIRRLPSTNMDDFEEVGLPK
HTVKEIRNVITVTKKYMGEKGLGAGENLNPSGDPTKLLSYQINQLKEKLHTSGMTMSDSV
KLPKNKKSAQTFHLKIPKRILEKYKVENVKLTIPGIGDVDYTKQYHDGEIILPANEEGIF
TVQVTLRLLDKKSKVDIFKPIPWGWKLHQKDIDNVDVPETAQIETAETPLVANVEVEATK
EQKHDKTQGGDKQTTEQKTAPETEPIQPGNGGESGSETGESEDGESPSDDGNPDESGTEE
PKDDEDSVPLEKLKPATKRVKIINNRINHEIMTPMEGMDKATNKLIRAVTNTVTPYQKLF
SSYESYFGLNMGSPSLPEQLKGKRLKDLATEDSLYYLFNKKDVPGLIKDYIVLQISDEVA
KQIRTPWENLQKQIAMHEQQVAQMNNNADALVRRINQTAKRATILNDSLEKTLQNVADWR
ERSLNLVDSQAKIQANEEDEQSAIVSLDENFQPLLSASQSLAEQAQGNVNEADTVYDTFD
SINEQATTIQESGDDIVQQVESLSVSMTNKLLEDEEFAENFTGVLANSRIGDRQNEDLYK
FLSNPVQTSNQGTITSSDSFTPYYLVLICFIVVLFTAYVISTINQKRVEQDLFSEEKSLV
GSNIPITLIIAGIGVLEGIVIGVVSSYTMHMTDGDMLMLTGLIVLLITGMLLISTYLLRQ
IKMIGMFVLLIVLSLYLFLTNAFGTGIKGMGLLKDFSPLQYVETLLLNVVHGEANYQASI
LIMIGIMIVGALANLFVVHRSTQKGEMDDENEAEVS
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattggataaacgctggttcctgtttttattattaatcgttatcctagcttcg
ggcttatcctatcttgcgttaaatcaacaagaacaaacagacaacgaagaaacggaagtt
gaaagggcaatggccattgcactcgttaatgaagatgagggatctatgttaaatggcgaa
aagattgcttttggtgatgcctttgtgcaaggagtgaacaatgaaaacaatcatgaatgg
tttgtagtcagtcgcggagttgcagaaagcggtttgaaacgtggtacatatgacatgatg
attgttattccgaatgatttttcccaaaaggcgctctcgattgattctgaatctccagaa
caagttgtattaaattataaaattaatgcgacggataacgagcaaataagagcggaagcg
gaaaaaacggctagtaatatcctaaatcgatttaatcgcagaattatcgacgtatatttt
gcaagtattgtcggaaatctgcaaaatgcgcaagataatattggtgaaattatcgaaaaa
caggcagtttatactaatacgctaagtaatgaagtatataacccgcttgataattacaca
aatcagtttgggtcgattaaagatagtacagagctgtccaaatcaagctttcaaagcttt
caggatatgatggatacttttgaaaatgaattagtagccgacgctgaattagatcaagat
tatttgtcaactgtaaatgatgttacccaattgaagaaaaaaaataacgttcagattctc
gaattctatcaaactttgaatgaatttgatggagtattaaatcagcaagaagccgaacag
caattggagcgtttgcagttagcaaataaaatgataaatgatcaattgcaaaacaacggt
gggggtatggaagaaattgaacctccgataaactctgtgatgtatcaacgcaacacggaa
gccaatattgctgttggagcgaacacgctaaagaaatatttagacgattcattagctcaa
gtacagaaaacgtatagcaatattgaaagaagaatcaatcccgattattcgggtggtttt
accggtgtaatttcagatcgattagatggtctgcttgccaatgtgctaggcaaagaagac
aaattggtaaatatgcttttgcaaaaaccagcagcaaatgcaaaaaattatttgcataag
caaataagacggttgccttcaacgaatatggacgactttgaagaagtaggtctgccaaag
catacagtgaaagagattaggaatgttattacggtaacaaaaaaatatatgggggaaaag
ggacttggggcaggtgaaaatcttaatccaagcggtgatccaaccaagttattatcatac
cagattaatcaactaaaggaaaaattgcatacttcagggatgactatgtctgactccgta
aagttgccgaaaaataaaaaatcagcgcaaacatttcatttaaaaataccaaagcgcatt
cttgaaaaatataaagtagaaaacgtaaaacttaccattcctggtattggagatgtggat
tatacgaagcaataccatgatggagaaattattcttccagcaaatgaagaaggtattttt
accgttcaggttacacttcgtttgcttgataagaagtcaaaagtagatattttcaagcca
attccttggggctggaagctgcatcaaaaagatattgataatgtagatgttccggaaaca
gcacaaattgaaacagcggaaacacctcttgttgcaaatgtagaggttgaagcaacaaaa
gaacaaaagcacgataaaactcaaggtggagataagcaaacaacagagcaaaagacagcc
ccagaaacagaaccaatacaaccaggtaatgggggagaaagtggatctgaaaccggtgaa
agcgaagacggagaaagtcctagtgatgatggcaaccctgatgaatcaggaacagaggaa
ccaaaggacgacgaagatagtgttccacttgaaaaacttaagccggcaaccaaacgggtt
aaaatcattaataatcgcattaaccatgaaattatgacgccaatggaaggaatggataag
gcaacgaataaattaattagagctgtaacgaatacggtaacgccttatcaaaaattattt
tcctcttatgaaagttatttcggtttaaatatggggagtcccagtttaccggaacaacta
aaaggtaaacgtttaaaagatttagcaactgaagattcattgtattatctctttaataaa
aaagatgttcccggcttaataaaagactatatcgttttacaaattagtgatgaagtagcc
aaacaaattcgcacgccttgggaaaatctacaaaaacaaattgcaatgcatgagcaacaa
gttgctcaaatgaacaataatgcagatgcattagtaagaaggatcaatcaaactgctaaa
agagcaacgatccttaacgatagtcttgaaaaaacattacaaaatgtcgcagactggcga
gagagaagcttgaacctagttgattcacaagcaaagattcaagcaaatgaggaagacgaa
caatctgctatcgtttccttggatgaaaactttcagcctctgctatcagctagtcaatca
cttgctgagcaagcgcaaggcaatgtgaatgaagcggatacagtatatgacactttcgat
agtattaatgaacaggcgacaacgattcaagaaagtggcgatgatatcgttcaacaagtc
gaatccttatccgtaagtatgaccaataaattacttgaagatgaagagtttgcagagaac
tttaccggtgtgttagcgaatagccgcattggtgacaggcaaaatgaagatttatataag
ttcttatccaacccagtacagacgagtaatcaaggaacgattacgtcaagcgattcgttt
acaccgtattacctcgtactaatttgctttattgtggtcttgtttacggcctatgttatt
tccacgataaaccaaaagcgcgtagaacaggatctattttctgaagaaaagtcactggta
ggcagcaatatcccaattacacttatcattgctgggataggtgttttagaaggtattgta
attggcgttgtatccagttatacaatgcacatgacagacggtgatatgctgatgcttaca
gggttgattgtcttgttaattaccggaatgttgctcatctccacatatttattaagacaa
ataaaaatgattggtatgttcgtgctcttaatcgtgctaagcctgtacctgtttttaacg
aatgcatttggaacaggcataaaagggatgggactgttgaaagatttctctccattgcaa
tatgtcgagacattattgttaaatgttgtacacggtgaagccaattatcaagcttcgatc
ttaatcatgatcggaatcatgatcgtaggtgctttagccaacttatttgtggtgcatcgc
tcaacacaaaaaggggaaatggacgatgaaaatgaagcagaagttagttaa

DBGET integrated database retrieval system