KEGG   Virgibacillus phasianinus: CFK37_01210Help
Entry
CFK37_01210       CDS       T04951                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00010  Glycolysis / Gluconeogenesis
vil00071  Fatty acid degradation
vil00280  Valine, leucine and isoleucine degradation
vil00310  Lysine degradation
vil00330  Arginine and proline metabolism
vil00340  Histidine metabolism
vil00380  Tryptophan metabolism
vil00410  beta-Alanine metabolism
vil00561  Glycerolipid metabolism
vil00620  Pyruvate metabolism
vil00625  Chloroalkane and chloroalkene degradation
vil00903  Limonene and pinene degradation
vil01100  Metabolic pathways
vil01110  Biosynthesis of secondary metabolites
vil01120  Microbial metabolism in diverse environments
vil01130  Biosynthesis of antibiotics
Module
vil_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:vil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFK37_01210
   00053 Ascorbate and aldarate metabolism
    CFK37_01210
   00620 Pyruvate metabolism
    CFK37_01210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFK37_01210
   00561 Glycerolipid metabolism
    CFK37_01210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFK37_01210
   00310 Lysine degradation
    CFK37_01210
   00330 Arginine and proline metabolism
    CFK37_01210
   00340 Histidine metabolism
    CFK37_01210
   00380 Tryptophan metabolism
    CFK37_01210
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFK37_01210
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFK37_01210
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CFK37_01210
Enzymes [BR:vil01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CFK37_01210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1542 DUF3813 TSP_NTD VASP_tetra
Motif
Other DBs
NCBI-ProteinID: ASK60925
UniProt: A0A220TYU8
LinkDB All DBs
Position
complement(246586..248004)
Genome map
AA seq 472 aa AA seqDB search
MRNELKHYINGEWVASSGSETMDVINPATEEVIGKISLGTREDLDKAVEAAKAALPSFSN
TTKEERIELLEKITAEYEKRKDDIVETITDELGSPLKMSEKVHYNMGYQHFSEAAKALKD
FSFSEDRGGHKIVKETIGVSGLITPWNFPTNQTTTKIASAFAAGSPVILKPSEMTPYAAI
ILAEIFDAVGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSVATGQKIMKNASETIK
NFALELGGKSPLVVLEDADIEKAAKGAVNHIAMNTGQVCSAATRIIVPSSIKKEFEEAVL
NVLPKFPVGSPREKSFIGPLISKKQWDTVQSYIEKGIDEGANLIAGGTGKPEGIDKGFYA
RPTIFTDVKNSMAIAQEEIFGPVMSIISYDTLDEAIEISNDTVYGLAGYVIGNNHETLSK
VAHGIKAGRITVNNAAADFTAPFGGYKQSGIGREWGDFGIEEYLETKAILGL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgaattaaagcattatattaatggggaatgggtagcatcatctggatctgaa
acaatggatgttatcaacccggctacagaggaagttattggcaaaatcagcttggggaca
agagaggacctggacaaggctgtagaggcagcaaaagctgcattgccttctttttcaaat
acaacgaaagaagagcggattgagttacttgagaagataactgctgagtacgagaaacgg
aaagatgatattgtcgagaccattactgatgaacttggttcaccacttaaaatgtcagaa
aaggtccattataacatgggttatcagcacttttccgaggctgcaaaggcccttaaagac
ttttcgttttcagaagaccgcggcggccacaagattgtgaaggaaacaataggtgtaagt
ggacttattacaccatggaatttcccaacaaaccaaacaactacaaaaattgccagtgca
tttgctgctggtagtcctgttattttaaaaccatcagaaatgacaccatatgcggcaatc
attttggctgagatttttgatgcagttggcgtgccaaaaggtgttttcaatctggtaaac
ggtactggggatgttattggtgatggtatcagttcacaccctgatatcgactttgtatca
tttacaggttccgtagccaccggccaaaaaatcatgaaaaacgcatcagaaacaattaaa
aactttgcgcttgaactaggtggaaaatcaccgttagtagtgctggaagacgcagacatt
gagaaggcggcaaaaggagctgtcaaccatattgcgatgaacacgggtcaagtatgttcc
gctgctactcgaattattgtgccttcctccattaagaaagaatttgaagaagcagtactc
aatgtgctaccgaaatttccagttggaagtcctcgggagaaatcgtttatcggaccgctt
atttcgaaaaaacagtgggatactgttcaatcctatattgaaaaaggaattgatgaaggt
gctaacctgattgctggcggaactggcaaacctgagggtattgataaaggattctatgca
cggccaactatttttacagatgtgaaaaatagcatggctattgcacaggaagagattttt
ggaccagtcatgtccattatttcgtatgatacgcttgatgaagcgattgaaatttcaaat
gataccgtatatggtttagcgggctatgttattggtaataaccatgaaacattaagtaaa
gtagcacatggcataaaggctgggcgcattacagtaaataatgctgcggcagactttaca
gcgccatttggcggttataagcagtccggcattggccgtgaatggggcgactttggtatt
gaagaatatctggaaacaaaagcaattttaggactgtaa

DBGET integrated database retrieval system