KEGG   Virgibacillus phasianinus: CFK37_03190Help
Entry
CFK37_03190       CDS       T04951                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00473  D-Alanine metabolism
vil01100  Metabolic pathways
vil01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFK37_03190 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CFK37_03190 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vil01011]
    CFK37_03190 (alr)
Enzymes [BR:vil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CFK37_03190 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:vil01011]
 Precursor biosynthesis
  Racemase
   CFK37_03190 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C MCR_alpha_N
Motif
Other DBs
NCBI-ProteinID: ASK64273
UniProt: A0A220U966
LinkDB All DBs
Position
complement(633667..634797)
Genome map
AA seq 376 aa AA seqDB search
MSDVFYRPTWVEVNLDAVAYNIAQMKQKLPSDSSIFAVVKADGYGHGAVKVAEAALQAGA
NALAVALLEEALELRHAGIKAPILVFGWVAPRDARIASEHDITLTFFQAEWLREVEAHLN
SKELKLHMKWDTGMGRLGIRTENELKSLVEALQTADHINLTGIYTHFATADEDDLTYFIE
QKKRFYHLLSVFNRIWGEPVDIHIGNSAASIRFPEKMHDFIRFGIAMYGLYPSQDVRNKQ
LINLKPAFSMHSRLVHVKNVARHESISYGATYITDHAEWIGTIPIGYADGWPRKLQGMEV
LIEGKRMPIVGRVCMDQTMIRLDKEYPVGTKVTLIGKNNGDEIEMDEIANFLETINYEIP
CMISERVPRIYVKNNG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacgtattttaccggccaacctgggtggaggttaacctggatgccgttgcttac
aatattgcacaaatgaaacaaaagctgccatcagacagttctatatttgccgttgtgaag
gcagatggatatggccatggtgcagttaaagtagctgaagccgccctgcaagcaggtgct
aatgctcttgctgtggcgctccttgaagaagcactggagttgcgtcatgctggaatcaaa
gcaccaatcttggtctttggctgggttgcgcctcgggatgcacggattgctagcgaacat
gatattacgcttacattttttcaagcagaatggcttcgagaggtagaagcacatttaaat
tcaaaagaattgaagcttcatatgaagtgggataccggtatgggacgattggggattcgc
acagaaaatgaacttaagtcattggtcgaagcgctccaaacagctgatcatattaattta
acagggatttacacccattttgctactgctgacgaagatgacttgacttattttattgaa
caaaagaaacgtttttatcaccttctgagcgtgtttaacagaatatggggtgagcctgtc
gatattcacattgggaatagtgctgcctctattcgttttccggaaaaaatgcatgatttt
atacgattcggcatagcgatgtatggattatatccatctcaagatgtgcggaacaaacag
ctaattaatttgaaacccgctttttcgatgcatagcaggctggtacatgtgaaaaatgtt
gctcgccatgagtcgattagttatggcgcaacctatataacagatcatgcggaatggatt
ggcacaataccaataggttatgcggatggctggccacggaaattgcagggaatggaagtt
ctcattgagggaaaaaggatgcctatcgttggaagggtatgcatggaccagacaatgatt
cgccttgataaggaatatcctgttggaactaaggttacactaattggaaagaacaatggc
gatgaaattgaaatggatgaaatagcaaatttcctggagaccattaactatgaaattccc
tgtatgattagtgaaagggttccaagaatctatgtaaaaaacaacggataa

DBGET integrated database retrieval system