KEGG   Virgibacillus phasianinus: CFK37_04320Help
Entry
CFK37_04320       CDS       T04951                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00473  D-Alanine metabolism
vil00550  Peptidoglycan biosynthesis
vil01100  Metabolic pathways
vil01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFK37_04320
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFK37_04320
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CFK37_04320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vil01011]
    CFK37_04320
Enzymes [BR:vil01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFK37_04320
Peptidoglycan biosynthesis and degradation proteins [BR:vil01011]
 Precursor biosynthesis
  Amino acid ligase
   CFK37_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ASK64286
UniProt: A0A220U8R8
LinkDB All DBs
Position
complement(849704..850810)
Genome map
AA seq 368 aa AA seqDB search
MNKIKVGIIFGGKSAEHEVSLQSAKNIVDAIDKTKYEVVLIGIDKQGKWHINDQTSYLIN
EENPKLIQLNKSNENVAIIPGETDHQLIHASKETSMDQLDVIFPIVHGTLGEDGSIQGML
RIANLPFVGTSVLGSAVCMDKDIAKRLLKEASINVAKGLSFTRAKKDTINFDEAKQQLGV
PMFIKPANQGSSVGVSKVSSKDEFDGAIQEAFQFDHKIIIEENIFGREIECAVLGNENPK
ASVPGEILPQTEFYSYESKYIDESGAKLAIPADLTDEEVEKIKAAAVHVFQTLECEGLAR
VDFFLKENGEIYVNEVNTLPGFTRISMYPKLWEISGITYPELINQLIELAIERHQLNNML
KSAVWDEE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattaaagtggggattattttcggcgggaagtccgctgaacatgaagtgtcc
ttacaatcagcgaaaaacattgtggatgcaattgataaaaccaaatatgaagttgtctta
attggaattgataaacaaggtaagtggcatatcaatgatcaaacatcatacttaataaat
gaagagaaccccaaattaattcagttaaataaatcaaatgaaaatgtggcaattatacca
ggtgagacggatcatcagcttattcatgcatcaaaagaaacgagtatggatcagttggat
gtcatctttccgattgttcatggtacgctgggtgaagatggcagtattcaagggatgctg
cgaatcgcaaatttgccatttgttggcacaagtgttttaggatctgctgtctgcatggat
aaagacattgcaaagcgtctgttaaaagaagccagcataaatgttgcgaaaggtctttca
tttacacgagcgaaaaaagataccattaattttgatgaggcgaaacagcaattgggtgtg
cccatgtttattaaaccagcgaatcagggttcttctgttggcgtaagcaaagtatcatca
aaggatgaatttgatggagcaatacaagaggcgtttcagtttgatcacaaaataatcatt
gaagaaaatatttttgggcgggaaattgagtgtgccgtgctcggcaatgaaaatccaaaa
gcatctgttccaggtgaaattctgccacagacggaattttattcgtatgaatctaagtat
atcgatgaaagcggtgcaaaattagccataccagcggatctaactgacgaagaagttgaa
aagattaaagccgctgccgttcatgtatttcaaacattggaatgtgaagggttggcacgt
gtggactttttcttaaaagaaaatggcgaaatatatgtgaatgaagtgaacacattacct
ggctttacacgcataagcatgtatcctaaattgtgggagatcagcggaattacctatcca
gaactaatcaatcagctgattgaattagcaatcgaacgacaccaactaaacaacatgcta
aaaagcgccgtttgggatgaagaatag

DBGET integrated database retrieval system