KEGG   Virgibacillus phasianinus: CFK37_10475Help
Entry
CFK37_10475       CDS       T04951                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00040  Pentose and glucuronate interconversions
vil00051  Fructose and mannose metabolism
vil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFK37_10475
   00051 Fructose and mannose metabolism
    CFK37_10475
Enzymes [BR:vil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CFK37_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 HI0933_like AlaDh_PNT_C NAD_binding_3 FAD_binding_3 KptA_kDCL
Motif
Other DBs
NCBI-ProteinID: ASK62543
UniProt: A0A220U492
LinkDB All DBs
Position
2180526..2181557
Genome map
AA seq 343 aa AA seqDB search
MKALVKTELGFGNLEIQDKEEPQAGKDQVKIKVKYAGICGSDIHTYEGHYKVGVPVTLGH
EFSGEVVEVGEGVTEFKPGDRVTSETTFYICGECEYCKAGDYNLCSHRKGLGTQQDGGFT
NYLIARKESVHKLPDNVDYQSAAMTEPLACTHHGVSKTEINHGDIVVVIGPGPIGLFTAQ
VAKSRGATVLITGLTNDKVRLDKAKELGIDYAVNTQKQDIKELVNSLTNGYGADVVFECS
GAVPAAKQGLDLLRKKGQYGQIGLFAQPEVSFDLEKIIQKEIRVVGSRSQKPADWEPSLE
LMNNGSVNAKAMVTHEFNITQWDEAYQAIKSGEAIKVLLTPVD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacttgtaaaaacagaactcggatttggtaatctggaaattcaagataaagaa
gaaccgcaagccggcaaagatcaagtgaaaatcaaagtgaaatatgcggggatttgcggg
tctgatattcatacctatgaagggcattacaaggttggtgtcccggtaacattggggcat
gagttttctggtgaagtggttgaagtcggtgagggtgttacagaatttaagcccggtgac
cgcgttacctcagaaacaaccttttatatttgcggagagtgtgaatattgcaaggctggt
gattacaatttatgtagccaccggaagggacttggaactcagcaggatggtggctttaca
aactatttaattgctcgtaaagagagcgtccataaacttccggacaatgtggattaccaa
tctgcagcgatgacggaaccacttgcatgtacccatcacggtgtatcaaaaacggaaatc
aatcatggcgatattgttgttgtcattggacctggtccgattggactgttcaccgcacaa
gttgccaaaagccgcggtgctacagttctaattacaggtttaacgaatgataaagtacgt
ttggataaagcgaaggaattgggaatcgattatgcagtaaatacgcaaaagcaggatatc
aaagaacttgtcaacagcctgacaaatggttatggcgcagatgttgtatttgaatgctcg
ggtgcagtaccagctgccaagcaggggcttgacctattgcgtaagaaaggtcaatatggg
caaattggactttttgctcaaccggaagtttcctttgatcttgaaaaaattattcaaaaa
gaaatccgtgttgttggaagcagaagtcaaaaacctgctgactgggagccatcgctagaa
ctaatgaacaatggcagtgtaaatgccaaggcaatggtcacacatgaatttaatattacc
caatgggacgaagcgtaccaggcgattaaaagtggagaagccatcaaggtattgttaacg
ccagtagattaa

DBGET integrated database retrieval system