KEGG   Virgibacillus phasianinus: CFK37_12935Help
Entry
CFK37_12935       CDS       T04951                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00010  Glycolysis / Gluconeogenesis
vil00030  Pentose phosphate pathway
vil00051  Fructose and mannose metabolism
vil00052  Galactose metabolism
vil00680  Methane metabolism
vil01100  Metabolic pathways
vil01110  Biosynthesis of secondary metabolites
vil01120  Microbial metabolism in diverse environments
vil01130  Biosynthesis of antibiotics
vil01200  Carbon metabolism
vil01230  Biosynthesis of amino acids
vil03018  RNA degradation
Module
vil_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFK37_12935 (pfkA)
   00030 Pentose phosphate pathway
    CFK37_12935 (pfkA)
   00051 Fructose and mannose metabolism
    CFK37_12935 (pfkA)
   00052 Galactose metabolism
    CFK37_12935 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CFK37_12935 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CFK37_12935 (pfkA)
Enzymes [BR:vil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CFK37_12935 (pfkA)
Protein phosphatases and associated proteins [BR:vil01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CFK37_12935 (pfkA)
Messenger RNA biogenesis [BR:vil03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CFK37_12935 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat AhpC-TSA_2 PucR DUF2675
Motif
Other DBs
NCBI-ProteinID: ASK62983
UniProt: A0A220U5I5
LinkDB All DBs
Position
2706554..2707513
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRKAIFHGVDIYGIKNGFQGLMEGNISKMEIGSVGDI
IQRGGTILFSARSTEFKTPKGQQKAIQQLKRHGIEGLIVIGGDGSFRGAQKLTENGFPCI
GVPGTIDNDIPGTDFTIGFDTALNTIIEAIDKIRDTATSHERTYVIEVMGRDAGDLALWA
GLADGAESILIPEKKDDFEAVINKLKRGHDRGKKHSIIILAEGVGSGFSYGKRIQDATNL
ETRVTVLGHIQRGGSPTAADRVLASRLGAKAVDLLLGGEGGRVVGIQQNKLVDHNILEIL
NQKHAINMEMYQLSNELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagctgttttaactagtggtggtgatgcaccaggaatgaatgctgcaatt
cgggctgttgtacgaaaagctatttttcatggagtagacatatatgggatcaaaaatgga
tttcagggcctaatggaaggtaacattagcaaaatggaaataggttccgtaggtgatatt
attcagcgcggcgggacaatcttattctcagcaagaagtacggaatttaaaaccccaaag
ggccagcagaaagctattcaacaacttaaaaggcatggcatcgaaggtctgattgtaatt
ggtggagacgggagctttcgtggagcccaaaaattaacggaaaatggttttccatgtatt
ggagttcccggtacgattgataatgatatacccggaactgattttacaattggttttgat
acagctctaaatactattattgaagctattgataaaattagagatactgctacttcgcat
gaacggacatacgtcattgaggtaatgggccgtgatgcaggtgatctagccctatgggcc
ggccttgcagatggagctgaaagtatattaattcctgaaaagaaggatgatttcgaagca
gttatcaataaattaaaaagagggcatgaccgtgggaagaaacatagtattattatttta
gctgaaggcgtcggcagcggtttttcgtatgggaagcgaatccaggatgcaacaaatcta
gaaacgcgcgttacggtattaggtcatattcaacgcggagggtcacctaccgcagctgat
agagtgttagccagccgcttaggagctaaagctgttgatttgctgctcggcggtgaaggt
ggccgggtagttggaattcaacaaaataaattagttgatcacaacatattggagatatta
aatcaaaaacatgcaattaatatggaaatgtatcaattatcgaatgaattgtctatctaa

DBGET integrated database retrieval system